Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KCK5

Protein Details
Accession Q5KCK5   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-117EIEKAKEGKPKKSTKRKKAPTTAADFGHydrophilic
NLS Segment(s)
PositionSequence
94-109KAKEGKPKKSTKRKKA
242-253RLKPEAAKKKEK
Subcellular Location(s) nucl 18.5, mito_nucl 13.166, cyto_nucl 11.333, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0030687  C:preribosome, large subunit precursor  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0000470  P:maturation of LSU-rRNA  
KEGG cne:CNH01340  -  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MSVPSLKSALKKPTKSFDTPPAGPSKLSVAAAVPEKSKAKAKQSVSIAEKPQRLRGPDLESESEGNASGFEDESASEVEVDEDEEMNTDEEIEKAKEGKPKKSTKRKKAPTTAADFGATLTSLLADPLTKSNKKAKTADSTKKAAAAPILALSAHKLPTKASVSLEAKAKRQLKAEKEEKEDRARVQNVLEGWSGDGVVGGQEFERNLRKTAQKGVVKLFNAILVASKNAEAAQTTLSEKARLKPEAAKKKEKDNILGRGGKEDVLTKESFLEMVRKGSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.7
3 0.69
4 0.69
5 0.68
6 0.62
7 0.61
8 0.57
9 0.52
10 0.45
11 0.4
12 0.34
13 0.29
14 0.27
15 0.23
16 0.17
17 0.19
18 0.23
19 0.24
20 0.2
21 0.21
22 0.23
23 0.25
24 0.33
25 0.35
26 0.39
27 0.46
28 0.49
29 0.52
30 0.55
31 0.61
32 0.6
33 0.6
34 0.59
35 0.58
36 0.6
37 0.54
38 0.57
39 0.53
40 0.5
41 0.49
42 0.47
43 0.46
44 0.45
45 0.48
46 0.43
47 0.39
48 0.37
49 0.32
50 0.27
51 0.21
52 0.15
53 0.1
54 0.08
55 0.07
56 0.06
57 0.06
58 0.06
59 0.05
60 0.07
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.08
79 0.08
80 0.08
81 0.09
82 0.13
83 0.19
84 0.23
85 0.31
86 0.38
87 0.48
88 0.58
89 0.68
90 0.76
91 0.81
92 0.88
93 0.9
94 0.91
95 0.91
96 0.89
97 0.85
98 0.82
99 0.73
100 0.63
101 0.53
102 0.43
103 0.33
104 0.24
105 0.16
106 0.08
107 0.05
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.04
114 0.08
115 0.13
116 0.14
117 0.17
118 0.25
119 0.3
120 0.35
121 0.38
122 0.39
123 0.44
124 0.52
125 0.58
126 0.55
127 0.53
128 0.48
129 0.48
130 0.43
131 0.34
132 0.25
133 0.17
134 0.12
135 0.09
136 0.09
137 0.06
138 0.06
139 0.06
140 0.07
141 0.08
142 0.09
143 0.09
144 0.09
145 0.14
146 0.17
147 0.17
148 0.16
149 0.22
150 0.23
151 0.26
152 0.32
153 0.29
154 0.28
155 0.34
156 0.37
157 0.33
158 0.37
159 0.42
160 0.42
161 0.5
162 0.56
163 0.54
164 0.58
165 0.62
166 0.6
167 0.6
168 0.56
169 0.5
170 0.49
171 0.45
172 0.39
173 0.33
174 0.31
175 0.25
176 0.25
177 0.22
178 0.14
179 0.12
180 0.11
181 0.1
182 0.07
183 0.07
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.04
190 0.05
191 0.08
192 0.14
193 0.16
194 0.18
195 0.23
196 0.28
197 0.3
198 0.39
199 0.45
200 0.44
201 0.46
202 0.5
203 0.51
204 0.47
205 0.46
206 0.37
207 0.29
208 0.24
209 0.21
210 0.16
211 0.1
212 0.11
213 0.1
214 0.1
215 0.09
216 0.09
217 0.09
218 0.08
219 0.08
220 0.09
221 0.1
222 0.11
223 0.15
224 0.16
225 0.2
226 0.22
227 0.27
228 0.33
229 0.33
230 0.35
231 0.4
232 0.5
233 0.57
234 0.62
235 0.67
236 0.63
237 0.72
238 0.76
239 0.72
240 0.71
241 0.68
242 0.69
243 0.67
244 0.68
245 0.58
246 0.56
247 0.52
248 0.43
249 0.36
250 0.32
251 0.26
252 0.25
253 0.25
254 0.21
255 0.22
256 0.21
257 0.21
258 0.17
259 0.19
260 0.17
261 0.21