Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4GVS5

Protein Details
Accession A0A0F4GVS5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-106ERSVRMKSLEKLRPRRKPKPTLIDGDGBasic
NLS Segment(s)
PositionSequence
89-98EKLRPRRKPK
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019236  APP1_cat  
Gene Ontology GO:0008195  F:phosphatidate phosphatase activity  
Pfam View protein in Pfam  
PF09949  APP1_cat  
Amino Acid Sequences MVSISGPFSHLRQSTSNASCIFRGDKQARYSPEVTCDLSKEMPDLFERLPRMFPWDKSRPVDPEEHTVWLLDNTAFQTQERSVRMKSLEKLRPRRKPKPTLIDGDGKEVAVRRRDESGWQAEFVASYFVKDSGADVSHVIAAIARMLHIDETDIATRQRIAERVQPFADTVLVKRTLRIDVGGREQVTLGPSTSNGISTDVVSLHFDPMRTGPMTSTPIDLKTAPNLAGRTLYYPPTGYLLLSDIDDTIKTTLTPSPMGIIHSTFITSTPLPIANMPDLYSSLATLLSSPPFFYLSASPYPLYPFLRPFLSTHYPPGTVLLRDASWQNLGGLIASLTRGVEAYKISQMRKVHSWFPKRKVVCIGDSTQRDVESYCSVARQFPGWVEAVFIRRVVGVEGMDEEEKNAPKRFERAFRGLEEKGVVCRVFDEPEEVRVLVEEMVRRDECRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.45
4 0.4
5 0.41
6 0.37
7 0.38
8 0.37
9 0.31
10 0.38
11 0.38
12 0.42
13 0.46
14 0.53
15 0.55
16 0.57
17 0.57
18 0.49
19 0.5
20 0.47
21 0.43
22 0.38
23 0.35
24 0.31
25 0.3
26 0.28
27 0.24
28 0.21
29 0.2
30 0.2
31 0.21
32 0.19
33 0.23
34 0.25
35 0.25
36 0.27
37 0.25
38 0.31
39 0.33
40 0.36
41 0.4
42 0.46
43 0.52
44 0.54
45 0.59
46 0.56
47 0.55
48 0.57
49 0.51
50 0.5
51 0.45
52 0.43
53 0.38
54 0.33
55 0.3
56 0.23
57 0.21
58 0.13
59 0.12
60 0.12
61 0.13
62 0.14
63 0.13
64 0.16
65 0.17
66 0.23
67 0.25
68 0.27
69 0.26
70 0.3
71 0.35
72 0.37
73 0.41
74 0.46
75 0.5
76 0.57
77 0.67
78 0.72
79 0.79
80 0.83
81 0.87
82 0.87
83 0.9
84 0.9
85 0.89
86 0.86
87 0.83
88 0.78
89 0.76
90 0.67
91 0.61
92 0.51
93 0.4
94 0.34
95 0.3
96 0.29
97 0.26
98 0.27
99 0.24
100 0.27
101 0.28
102 0.31
103 0.34
104 0.38
105 0.33
106 0.32
107 0.3
108 0.26
109 0.25
110 0.21
111 0.18
112 0.1
113 0.09
114 0.09
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.1
121 0.1
122 0.09
123 0.1
124 0.1
125 0.1
126 0.09
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.1
144 0.11
145 0.13
146 0.13
147 0.15
148 0.21
149 0.23
150 0.26
151 0.26
152 0.25
153 0.24
154 0.22
155 0.21
156 0.14
157 0.13
158 0.13
159 0.17
160 0.16
161 0.17
162 0.18
163 0.17
164 0.17
165 0.18
166 0.17
167 0.16
168 0.21
169 0.22
170 0.21
171 0.2
172 0.19
173 0.18
174 0.16
175 0.14
176 0.1
177 0.07
178 0.07
179 0.08
180 0.08
181 0.08
182 0.07
183 0.08
184 0.08
185 0.08
186 0.09
187 0.08
188 0.08
189 0.09
190 0.09
191 0.09
192 0.09
193 0.09
194 0.09
195 0.09
196 0.11
197 0.1
198 0.1
199 0.09
200 0.11
201 0.14
202 0.14
203 0.15
204 0.13
205 0.13
206 0.15
207 0.15
208 0.13
209 0.11
210 0.12
211 0.12
212 0.13
213 0.13
214 0.12
215 0.12
216 0.12
217 0.13
218 0.13
219 0.13
220 0.12
221 0.12
222 0.12
223 0.12
224 0.12
225 0.09
226 0.08
227 0.08
228 0.08
229 0.08
230 0.07
231 0.06
232 0.06
233 0.06
234 0.06
235 0.05
236 0.05
237 0.05
238 0.06
239 0.08
240 0.09
241 0.1
242 0.09
243 0.11
244 0.11
245 0.12
246 0.12
247 0.11
248 0.09
249 0.09
250 0.09
251 0.07
252 0.07
253 0.08
254 0.08
255 0.08
256 0.09
257 0.09
258 0.09
259 0.1
260 0.11
261 0.1
262 0.1
263 0.1
264 0.1
265 0.1
266 0.1
267 0.09
268 0.07
269 0.07
270 0.06
271 0.06
272 0.06
273 0.06
274 0.07
275 0.07
276 0.08
277 0.08
278 0.09
279 0.09
280 0.1
281 0.11
282 0.13
283 0.15
284 0.17
285 0.16
286 0.15
287 0.17
288 0.19
289 0.2
290 0.18
291 0.18
292 0.18
293 0.2
294 0.21
295 0.2
296 0.25
297 0.28
298 0.27
299 0.3
300 0.3
301 0.29
302 0.28
303 0.3
304 0.25
305 0.19
306 0.19
307 0.16
308 0.13
309 0.14
310 0.15
311 0.13
312 0.12
313 0.12
314 0.11
315 0.1
316 0.1
317 0.08
318 0.08
319 0.06
320 0.05
321 0.05
322 0.05
323 0.04
324 0.05
325 0.05
326 0.05
327 0.06
328 0.07
329 0.09
330 0.15
331 0.2
332 0.2
333 0.26
334 0.28
335 0.32
336 0.38
337 0.4
338 0.43
339 0.48
340 0.58
341 0.62
342 0.67
343 0.72
344 0.66
345 0.67
346 0.67
347 0.62
348 0.56
349 0.52
350 0.5
351 0.49
352 0.5
353 0.49
354 0.41
355 0.37
356 0.32
357 0.27
358 0.25
359 0.19
360 0.19
361 0.16
362 0.16
363 0.17
364 0.19
365 0.19
366 0.18
367 0.17
368 0.16
369 0.18
370 0.17
371 0.16
372 0.16
373 0.18
374 0.19
375 0.18
376 0.17
377 0.15
378 0.14
379 0.15
380 0.13
381 0.12
382 0.1
383 0.1
384 0.11
385 0.13
386 0.13
387 0.13
388 0.13
389 0.16
390 0.2
391 0.24
392 0.27
393 0.28
394 0.3
395 0.38
396 0.44
397 0.49
398 0.53
399 0.57
400 0.57
401 0.59
402 0.62
403 0.56
404 0.51
405 0.45
406 0.38
407 0.33
408 0.33
409 0.28
410 0.21
411 0.22
412 0.22
413 0.21
414 0.21
415 0.24
416 0.21
417 0.24
418 0.26
419 0.24
420 0.22
421 0.2
422 0.2
423 0.16
424 0.18
425 0.18
426 0.18
427 0.24
428 0.25