Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4GUA7

Protein Details
Accession A0A0F4GUA7   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-41YAACSKPKKLMLRVRPRDKLTHydrophilic
NLS Segment(s)
PositionSequence
85-102KLSPRKKFFIKLSPRKEK
Subcellular Location(s) nucl 18, mito_nucl 12.999, cyto_nucl 11.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MAPIDNTNATSISSMASIPDYAACSKPKKLMLRVRPRDKLTIKLSPRKMAYLEEEAIRVKQQEESPSEKKFTIKVSPRKEKCVIKLSPRKKFFIKLSPRKEKVAIKAEEVEVKREDETPCKRFTVKLSPRRETEVVHKEAVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.08
5 0.08
6 0.09
7 0.1
8 0.12
9 0.15
10 0.19
11 0.22
12 0.25
13 0.3
14 0.36
15 0.41
16 0.49
17 0.56
18 0.62
19 0.7
20 0.77
21 0.81
22 0.82
23 0.78
24 0.78
25 0.7
26 0.68
27 0.63
28 0.62
29 0.59
30 0.61
31 0.61
32 0.58
33 0.56
34 0.5
35 0.45
36 0.38
37 0.35
38 0.3
39 0.28
40 0.22
41 0.22
42 0.2
43 0.19
44 0.17
45 0.13
46 0.09
47 0.11
48 0.13
49 0.16
50 0.2
51 0.27
52 0.3
53 0.31
54 0.32
55 0.3
56 0.29
57 0.26
58 0.26
59 0.27
60 0.32
61 0.39
62 0.47
63 0.57
64 0.58
65 0.63
66 0.67
67 0.63
68 0.6
69 0.6
70 0.55
71 0.54
72 0.62
73 0.65
74 0.68
75 0.67
76 0.65
77 0.59
78 0.62
79 0.57
80 0.58
81 0.6
82 0.6
83 0.67
84 0.73
85 0.74
86 0.7
87 0.7
88 0.65
89 0.63
90 0.62
91 0.53
92 0.46
93 0.46
94 0.44
95 0.45
96 0.4
97 0.35
98 0.27
99 0.26
100 0.24
101 0.24
102 0.25
103 0.27
104 0.35
105 0.35
106 0.37
107 0.39
108 0.39
109 0.39
110 0.43
111 0.46
112 0.48
113 0.53
114 0.6
115 0.63
116 0.66
117 0.7
118 0.65
119 0.58
120 0.58
121 0.58
122 0.52
123 0.48