Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZJG1

Protein Details
Accession A0A0F4ZJG1   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
218-237TVTFTPRMKPAPKGKRRKAEHydrophilic
NLS Segment(s)
PositionSequence
224-237RMKPAPKGKRRKAE
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAATCKPKLPQLSTPVNSNFPISISGPSPLSAHPRSANDSSRTPISPPSAYIEYLQRWSLNSPMISRPSYSGNTTPSTASSHSSCSCKAAASAAIAAAAGEAPPTSNPASVTIKQEPGLHAPLTAPPAPLSPFTRVPMSAPANGASFPSLKVPPSPAPALSPYPTDSPMSARSPFSARGYTTKFDWDAALKARPTAGEIRKQSSRTNVRHIREVVTRTVTFTPRMKPAPKGKRRKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.55
4 0.49
5 0.43
6 0.35
7 0.25
8 0.26
9 0.2
10 0.19
11 0.17
12 0.18
13 0.17
14 0.17
15 0.18
16 0.17
17 0.23
18 0.22
19 0.25
20 0.27
21 0.3
22 0.35
23 0.39
24 0.43
25 0.4
26 0.41
27 0.41
28 0.4
29 0.38
30 0.33
31 0.33
32 0.31
33 0.28
34 0.26
35 0.29
36 0.27
37 0.26
38 0.27
39 0.27
40 0.24
41 0.26
42 0.25
43 0.2
44 0.19
45 0.2
46 0.2
47 0.19
48 0.18
49 0.19
50 0.22
51 0.26
52 0.25
53 0.25
54 0.24
55 0.25
56 0.26
57 0.26
58 0.24
59 0.24
60 0.25
61 0.25
62 0.24
63 0.21
64 0.21
65 0.19
66 0.18
67 0.16
68 0.18
69 0.19
70 0.21
71 0.2
72 0.2
73 0.19
74 0.17
75 0.16
76 0.14
77 0.12
78 0.11
79 0.1
80 0.08
81 0.07
82 0.07
83 0.06
84 0.05
85 0.04
86 0.03
87 0.02
88 0.02
89 0.03
90 0.03
91 0.05
92 0.06
93 0.06
94 0.07
95 0.11
96 0.15
97 0.17
98 0.22
99 0.22
100 0.22
101 0.23
102 0.24
103 0.21
104 0.2
105 0.2
106 0.15
107 0.13
108 0.12
109 0.12
110 0.14
111 0.14
112 0.11
113 0.09
114 0.1
115 0.11
116 0.13
117 0.14
118 0.15
119 0.16
120 0.17
121 0.18
122 0.18
123 0.18
124 0.22
125 0.23
126 0.2
127 0.19
128 0.19
129 0.18
130 0.18
131 0.17
132 0.11
133 0.09
134 0.08
135 0.11
136 0.1
137 0.11
138 0.12
139 0.16
140 0.17
141 0.21
142 0.22
143 0.19
144 0.2
145 0.23
146 0.25
147 0.22
148 0.21
149 0.19
150 0.19
151 0.2
152 0.19
153 0.17
154 0.17
155 0.2
156 0.22
157 0.22
158 0.21
159 0.21
160 0.23
161 0.26
162 0.26
163 0.25
164 0.23
165 0.28
166 0.31
167 0.31
168 0.3
169 0.31
170 0.29
171 0.26
172 0.26
173 0.22
174 0.21
175 0.23
176 0.26
177 0.22
178 0.22
179 0.22
180 0.2
181 0.21
182 0.27
183 0.28
184 0.33
185 0.36
186 0.42
187 0.47
188 0.49
189 0.5
190 0.52
191 0.56
192 0.53
193 0.6
194 0.63
195 0.62
196 0.68
197 0.66
198 0.61
199 0.57
200 0.55
201 0.5
202 0.47
203 0.43
204 0.39
205 0.41
206 0.39
207 0.37
208 0.38
209 0.38
210 0.4
211 0.47
212 0.47
213 0.51
214 0.6
215 0.66
216 0.72
217 0.78