Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4ZGI2

Protein Details
Accession A0A0F4ZGI2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-69KSPEESSQKNDKKRDKHMDNEQEEAcidic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 9.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEPTVQPEPAAPAEPTKKPFALPLALALPKMYLYGSAFMPQDVNEKSPEESSQKNDKKRDKHMDNEQEEMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.33
4 0.32
5 0.3
6 0.32
7 0.29
8 0.26
9 0.22
10 0.21
11 0.21
12 0.21
13 0.2
14 0.17
15 0.14
16 0.11
17 0.11
18 0.08
19 0.05
20 0.05
21 0.07
22 0.07
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.12
29 0.12
30 0.13
31 0.12
32 0.14
33 0.15
34 0.16
35 0.18
36 0.18
37 0.2
38 0.25
39 0.35
40 0.41
41 0.48
42 0.57
43 0.63
44 0.68
45 0.75
46 0.8
47 0.77
48 0.79
49 0.82
50 0.83
51 0.78