Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZAB9

Protein Details
Accession A0A0F4ZAB9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-30LAQRHAIRRIAKKYERKDAEAHydrophilic
NLS Segment(s)
PositionSequence
328-333RKAERK
Subcellular Location(s) mito 13, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008991  Translation_prot_SH3-like_sf  
Amino Acid Sequences MDKIARRTHLAQRHAIRRIAKKYERKDAEARVNTRRQAVEATREVLDNRKLAIAQSRALWKQGPLAPNMQSVPTYGVVNHPLRLDNREVKLRDDIVKERCQWAGGLRYLSLALGDKVVFVEGPMKGKMDTIMEISPETGSVRLSNFKYRTRVPAFIEKLYKNETAFNPEMDSNPAIPISAIRLVHPIVDAKTGIARDVIVDTIQPANIRRDDITGTTEWDRVIPGLNVILPWPPKERPENPLYAADTARTDIALETFVPTLLRPPMPASLIDELRGKFSVFRTRHEEWYVAKKEAEEAERKARRALGPNKTPVDASMLSPEMEASKARKAERKARGQPELSEEMLAKIGEIMAKNQSAMLDAAGVQKVESPLASRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.69
4 0.69
5 0.72
6 0.73
7 0.74
8 0.75
9 0.77
10 0.82
11 0.8
12 0.78
13 0.77
14 0.75
15 0.76
16 0.75
17 0.73
18 0.71
19 0.72
20 0.68
21 0.66
22 0.58
23 0.49
24 0.47
25 0.46
26 0.45
27 0.41
28 0.41
29 0.36
30 0.36
31 0.36
32 0.34
33 0.33
34 0.26
35 0.24
36 0.23
37 0.22
38 0.22
39 0.29
40 0.26
41 0.23
42 0.26
43 0.32
44 0.31
45 0.33
46 0.33
47 0.26
48 0.31
49 0.34
50 0.32
51 0.28
52 0.32
53 0.31
54 0.33
55 0.33
56 0.27
57 0.22
58 0.2
59 0.2
60 0.17
61 0.16
62 0.13
63 0.15
64 0.21
65 0.22
66 0.23
67 0.21
68 0.23
69 0.24
70 0.28
71 0.32
72 0.32
73 0.35
74 0.41
75 0.41
76 0.41
77 0.44
78 0.43
79 0.42
80 0.39
81 0.42
82 0.4
83 0.45
84 0.44
85 0.42
86 0.39
87 0.34
88 0.3
89 0.28
90 0.28
91 0.25
92 0.23
93 0.21
94 0.21
95 0.2
96 0.19
97 0.16
98 0.1
99 0.08
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.06
106 0.05
107 0.08
108 0.08
109 0.11
110 0.11
111 0.12
112 0.12
113 0.13
114 0.14
115 0.11
116 0.11
117 0.11
118 0.11
119 0.11
120 0.11
121 0.11
122 0.1
123 0.09
124 0.08
125 0.06
126 0.06
127 0.07
128 0.08
129 0.12
130 0.15
131 0.22
132 0.25
133 0.29
134 0.33
135 0.35
136 0.43
137 0.42
138 0.45
139 0.41
140 0.47
141 0.46
142 0.46
143 0.49
144 0.41
145 0.38
146 0.38
147 0.36
148 0.27
149 0.28
150 0.24
151 0.26
152 0.26
153 0.24
154 0.21
155 0.2
156 0.2
157 0.18
158 0.18
159 0.11
160 0.11
161 0.1
162 0.08
163 0.08
164 0.07
165 0.07
166 0.09
167 0.09
168 0.09
169 0.1
170 0.11
171 0.11
172 0.11
173 0.1
174 0.08
175 0.09
176 0.08
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.05
187 0.04
188 0.05
189 0.06
190 0.06
191 0.07
192 0.08
193 0.11
194 0.12
195 0.13
196 0.12
197 0.13
198 0.14
199 0.15
200 0.16
201 0.13
202 0.15
203 0.15
204 0.16
205 0.14
206 0.13
207 0.12
208 0.1
209 0.11
210 0.08
211 0.07
212 0.07
213 0.07
214 0.06
215 0.07
216 0.09
217 0.09
218 0.1
219 0.14
220 0.15
221 0.19
222 0.26
223 0.29
224 0.32
225 0.36
226 0.38
227 0.37
228 0.4
229 0.37
230 0.32
231 0.29
232 0.24
233 0.2
234 0.17
235 0.14
236 0.1
237 0.09
238 0.07
239 0.07
240 0.07
241 0.06
242 0.07
243 0.07
244 0.07
245 0.07
246 0.07
247 0.09
248 0.11
249 0.12
250 0.11
251 0.13
252 0.15
253 0.16
254 0.17
255 0.18
256 0.19
257 0.19
258 0.2
259 0.22
260 0.2
261 0.21
262 0.22
263 0.18
264 0.16
265 0.19
266 0.28
267 0.26
268 0.3
269 0.36
270 0.39
271 0.45
272 0.45
273 0.44
274 0.38
275 0.47
276 0.46
277 0.4
278 0.37
279 0.32
280 0.33
281 0.34
282 0.35
283 0.3
284 0.3
285 0.39
286 0.43
287 0.44
288 0.43
289 0.43
290 0.43
291 0.48
292 0.53
293 0.53
294 0.56
295 0.63
296 0.64
297 0.6
298 0.55
299 0.45
300 0.42
301 0.33
302 0.26
303 0.23
304 0.21
305 0.2
306 0.2
307 0.2
308 0.14
309 0.14
310 0.15
311 0.13
312 0.18
313 0.23
314 0.28
315 0.35
316 0.41
317 0.51
318 0.58
319 0.66
320 0.7
321 0.75
322 0.79
323 0.76
324 0.72
325 0.69
326 0.63
327 0.53
328 0.44
329 0.36
330 0.28
331 0.26
332 0.22
333 0.14
334 0.1
335 0.1
336 0.11
337 0.12
338 0.13
339 0.16
340 0.17
341 0.17
342 0.17
343 0.17
344 0.16
345 0.15
346 0.13
347 0.1
348 0.1
349 0.14
350 0.14
351 0.14
352 0.12
353 0.15
354 0.15
355 0.15
356 0.15