Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KIE1

Protein Details
Accession Q5KIE1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
196-215RLVRSRKPYLHESRHRHACSBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 12, mito 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001289  NFYA  
Gene Ontology GO:0016602  C:CCAAT-binding factor complex  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG cne:CND03290  -  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences MAASLPIFHLLPNHHPAYPPSPTFSDPAFSAQYDSAFPANMDLSKSSQHPLNGYPFPAPPGTSAPQYSSRHIPSYPNLVPPNFSRGSYPAVQGGEDPTTFLDLDLSQPGPSTYHQQQPQPQSAAHHYHQPDHEYVQSDAEDDESLVQVKEEQDERQEGEEQDADVDNEEPLYVNAKQYHRILKRRMARARLEELNRLVRSRKPYLHESRHRHACSRPRGKGGRFLTAEEIETLKRQEAEKASKGEDEAQASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.34
4 0.37
5 0.4
6 0.36
7 0.34
8 0.34
9 0.36
10 0.36
11 0.33
12 0.3
13 0.24
14 0.26
15 0.24
16 0.21
17 0.21
18 0.19
19 0.19
20 0.17
21 0.18
22 0.15
23 0.13
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.12
30 0.13
31 0.15
32 0.17
33 0.18
34 0.2
35 0.2
36 0.21
37 0.23
38 0.29
39 0.28
40 0.28
41 0.28
42 0.25
43 0.26
44 0.25
45 0.21
46 0.16
47 0.2
48 0.21
49 0.21
50 0.22
51 0.23
52 0.3
53 0.32
54 0.34
55 0.35
56 0.35
57 0.35
58 0.35
59 0.36
60 0.3
61 0.36
62 0.35
63 0.35
64 0.35
65 0.33
66 0.34
67 0.32
68 0.35
69 0.27
70 0.26
71 0.21
72 0.2
73 0.24
74 0.23
75 0.23
76 0.19
77 0.18
78 0.18
79 0.17
80 0.16
81 0.13
82 0.11
83 0.11
84 0.08
85 0.09
86 0.08
87 0.08
88 0.07
89 0.06
90 0.07
91 0.08
92 0.08
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.14
99 0.15
100 0.22
101 0.25
102 0.29
103 0.34
104 0.38
105 0.42
106 0.37
107 0.35
108 0.3
109 0.32
110 0.34
111 0.28
112 0.3
113 0.26
114 0.28
115 0.28
116 0.28
117 0.25
118 0.21
119 0.22
120 0.18
121 0.18
122 0.16
123 0.14
124 0.12
125 0.11
126 0.1
127 0.08
128 0.06
129 0.06
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.08
137 0.09
138 0.1
139 0.11
140 0.13
141 0.14
142 0.15
143 0.17
144 0.15
145 0.16
146 0.16
147 0.14
148 0.13
149 0.12
150 0.11
151 0.08
152 0.09
153 0.06
154 0.06
155 0.06
156 0.05
157 0.05
158 0.08
159 0.08
160 0.11
161 0.16
162 0.18
163 0.22
164 0.25
165 0.35
166 0.4
167 0.48
168 0.51
169 0.55
170 0.62
171 0.68
172 0.72
173 0.7
174 0.69
175 0.67
176 0.67
177 0.66
178 0.61
179 0.56
180 0.52
181 0.53
182 0.47
183 0.43
184 0.39
185 0.36
186 0.4
187 0.42
188 0.44
189 0.42
190 0.5
191 0.59
192 0.67
193 0.72
194 0.74
195 0.76
196 0.81
197 0.78
198 0.73
199 0.7
200 0.69
201 0.7
202 0.73
203 0.7
204 0.69
205 0.74
206 0.73
207 0.75
208 0.69
209 0.68
210 0.58
211 0.54
212 0.5
213 0.43
214 0.41
215 0.33
216 0.3
217 0.22
218 0.22
219 0.21
220 0.18
221 0.19
222 0.19
223 0.25
224 0.31
225 0.38
226 0.42
227 0.46
228 0.46
229 0.45
230 0.46
231 0.44
232 0.4