Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KC18

Protein Details
Accession Q5KC18    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
301-338SVYEGSEKKRKKGKRFKDDSERKFYRRRKRVLDLVETLBasic
NLS Segment(s)
PositionSequence
307-330EKKRKKGKRFKDDSERKFYRRRKR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0060963  P:positive regulation of ribosomal protein gene transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MTHPLAMPMDEHAIPMNNLQTVPPSPSNSLNHNLSIAFSRIYDQIESLKQTQAQNHLQALTDLERTVRLANAGVAEQVRQAVNEGITGMVQQAVRQAVNESMGMMVQSAVRQAMQGIIFSMNYTDGNIQAQAQPLSQQQQQSQLAHPQSQPPNGAPNSNTNNVHATPQGWGMPPAVNGYMSAPNVGAPPGSDPTSSLPNTLHSSLFNFAQGSASTSTLSSNHTHPHQQPAHQPSQPAAHAPPPSEPLVGHAQTKSQASTSQTHPSPGSSNSCFTMSREVKTVPDLWREYTVGLEGQPPVRSVYEGSEKKRKKGKRFKDDSERKFYRRRKRVLDLVETLIKKGIPEDQAAKRVEKLREDRKVTLNKLGEIIPELSPEQLAMI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.19
4 0.16
5 0.16
6 0.16
7 0.18
8 0.18
9 0.24
10 0.26
11 0.27
12 0.29
13 0.36
14 0.39
15 0.4
16 0.45
17 0.41
18 0.38
19 0.36
20 0.33
21 0.27
22 0.27
23 0.23
24 0.17
25 0.14
26 0.15
27 0.16
28 0.18
29 0.17
30 0.16
31 0.19
32 0.22
33 0.26
34 0.26
35 0.27
36 0.29
37 0.32
38 0.35
39 0.39
40 0.41
41 0.41
42 0.41
43 0.39
44 0.35
45 0.32
46 0.3
47 0.24
48 0.2
49 0.16
50 0.14
51 0.13
52 0.14
53 0.15
54 0.12
55 0.11
56 0.1
57 0.11
58 0.12
59 0.11
60 0.12
61 0.11
62 0.11
63 0.1
64 0.12
65 0.11
66 0.09
67 0.11
68 0.11
69 0.1
70 0.1
71 0.1
72 0.08
73 0.08
74 0.08
75 0.07
76 0.08
77 0.07
78 0.07
79 0.1
80 0.11
81 0.11
82 0.12
83 0.13
84 0.11
85 0.13
86 0.13
87 0.1
88 0.08
89 0.08
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.08
101 0.08
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.08
114 0.08
115 0.08
116 0.09
117 0.11
118 0.11
119 0.1
120 0.12
121 0.13
122 0.16
123 0.18
124 0.19
125 0.19
126 0.26
127 0.29
128 0.29
129 0.29
130 0.32
131 0.32
132 0.32
133 0.32
134 0.32
135 0.32
136 0.33
137 0.32
138 0.26
139 0.31
140 0.29
141 0.3
142 0.23
143 0.27
144 0.29
145 0.32
146 0.32
147 0.26
148 0.28
149 0.27
150 0.27
151 0.2
152 0.16
153 0.13
154 0.13
155 0.13
156 0.11
157 0.11
158 0.11
159 0.11
160 0.1
161 0.1
162 0.1
163 0.08
164 0.08
165 0.09
166 0.1
167 0.09
168 0.09
169 0.08
170 0.08
171 0.09
172 0.08
173 0.06
174 0.04
175 0.06
176 0.07
177 0.08
178 0.07
179 0.08
180 0.1
181 0.14
182 0.14
183 0.14
184 0.13
185 0.14
186 0.17
187 0.18
188 0.16
189 0.12
190 0.14
191 0.14
192 0.14
193 0.12
194 0.1
195 0.08
196 0.09
197 0.09
198 0.09
199 0.09
200 0.09
201 0.09
202 0.09
203 0.09
204 0.09
205 0.12
206 0.11
207 0.12
208 0.14
209 0.16
210 0.22
211 0.23
212 0.31
213 0.32
214 0.34
215 0.4
216 0.44
217 0.48
218 0.44
219 0.43
220 0.35
221 0.37
222 0.33
223 0.27
224 0.22
225 0.2
226 0.21
227 0.21
228 0.21
229 0.2
230 0.21
231 0.19
232 0.18
233 0.16
234 0.21
235 0.21
236 0.21
237 0.18
238 0.18
239 0.2
240 0.21
241 0.18
242 0.13
243 0.15
244 0.17
245 0.21
246 0.23
247 0.29
248 0.28
249 0.3
250 0.3
251 0.28
252 0.27
253 0.27
254 0.29
255 0.24
256 0.25
257 0.24
258 0.25
259 0.24
260 0.23
261 0.3
262 0.26
263 0.26
264 0.27
265 0.27
266 0.26
267 0.29
268 0.33
269 0.26
270 0.31
271 0.31
272 0.3
273 0.31
274 0.31
275 0.28
276 0.24
277 0.21
278 0.15
279 0.13
280 0.13
281 0.12
282 0.14
283 0.15
284 0.15
285 0.15
286 0.15
287 0.15
288 0.14
289 0.18
290 0.25
291 0.3
292 0.36
293 0.45
294 0.48
295 0.55
296 0.63
297 0.67
298 0.69
299 0.74
300 0.79
301 0.8
302 0.87
303 0.89
304 0.91
305 0.93
306 0.9
307 0.89
308 0.86
309 0.8
310 0.81
311 0.8
312 0.8
313 0.79
314 0.81
315 0.79
316 0.81
317 0.84
318 0.83
319 0.81
320 0.75
321 0.7
322 0.68
323 0.59
324 0.5
325 0.42
326 0.34
327 0.25
328 0.22
329 0.23
330 0.18
331 0.22
332 0.29
333 0.33
334 0.4
335 0.43
336 0.43
337 0.43
338 0.48
339 0.49
340 0.51
341 0.54
342 0.58
343 0.65
344 0.7
345 0.7
346 0.72
347 0.76
348 0.71
349 0.71
350 0.65
351 0.56
352 0.52
353 0.47
354 0.39
355 0.33
356 0.31
357 0.22
358 0.21
359 0.19
360 0.17
361 0.16