Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZFN3

Protein Details
Accession A0A0F4ZFN3   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
59-80GKYTDKPSEPPKKRTWSRSSNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023614  Porin_dom_sf  
IPR027246  Porin_Euk/Tom40  
Gene Ontology GO:0005741  C:mitochondrial outer membrane  
GO:0046930  C:pore complex  
GO:0015288  F:porin activity  
Pfam View protein in Pfam  
PF01459  Porin_3  
Amino Acid Sequences MAVPAFTDIAKPANDLLNRDFYHAAASTFEFKSNTPNNVAFKVTGKSSHDKVTNGALEGKYTDKPSEPPKKRTWSRSSNTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.24
4 0.29
5 0.29
6 0.31
7 0.3
8 0.23
9 0.25
10 0.22
11 0.2
12 0.13
13 0.14
14 0.15
15 0.15
16 0.16
17 0.14
18 0.13
19 0.2
20 0.23
21 0.23
22 0.23
23 0.25
24 0.26
25 0.27
26 0.27
27 0.21
28 0.19
29 0.18
30 0.15
31 0.15
32 0.17
33 0.19
34 0.21
35 0.25
36 0.26
37 0.26
38 0.27
39 0.29
40 0.27
41 0.24
42 0.25
43 0.2
44 0.18
45 0.18
46 0.19
47 0.16
48 0.17
49 0.18
50 0.16
51 0.21
52 0.3
53 0.41
54 0.46
55 0.52
56 0.59
57 0.69
58 0.76
59 0.81
60 0.81
61 0.8