Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZEL7

Protein Details
Accession A0A0F4ZEL7   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-53KTSTEFKTTYRSWKKKYRKMKARFDQVSRESRHydrophilic
316-336VSGIKHVKKKAKRPSGGAGDEBasic
NLS Segment(s)
PositionSequence
36-40KKYRK
296-330SRPAKKRRVGAEEEGRPKAGVSGIKHVKKKAKRPS
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR032742  Iec3  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF14612  Ino80_Iec3  
Amino Acid Sequences MSSSEIRRKPTDDDAISAPEAKTSTEFKTTYRSWKKKYRKMKARFDQVSRESRELYTNEMHAVETIKRIAIENDRLLDTLLTLNKTPQLPAKRRVDISMPLNPDANKALTLQCDSTPEDHRLPCGTSLRDLERLVPGCDLASMKRADPALDEELQPMPGSKYPVAFLSIDDIDTYLYKLNKKLAIPCKDRAASAANSGSAHLTPSARDYTLNNPTSEYNWLRKHAPKTFLQDAVPNPTPLSLSSTSKEKDLPSRTAPATTPTSASAGLGAMARGRLPKRGPRGTESEHSDDEDAGSRPAKKRRVGAEEEGRPKAGVSGIKHVKKKAKRPSGGAGDEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.43
4 0.4
5 0.31
6 0.24
7 0.22
8 0.19
9 0.19
10 0.19
11 0.22
12 0.25
13 0.26
14 0.26
15 0.33
16 0.36
17 0.45
18 0.52
19 0.58
20 0.6
21 0.7
22 0.8
23 0.82
24 0.89
25 0.9
26 0.89
27 0.9
28 0.93
29 0.92
30 0.93
31 0.91
32 0.85
33 0.84
34 0.8
35 0.79
36 0.73
37 0.65
38 0.56
39 0.49
40 0.48
41 0.39
42 0.37
43 0.31
44 0.26
45 0.25
46 0.23
47 0.22
48 0.18
49 0.19
50 0.15
51 0.14
52 0.14
53 0.13
54 0.13
55 0.14
56 0.16
57 0.2
58 0.25
59 0.26
60 0.27
61 0.27
62 0.27
63 0.26
64 0.23
65 0.17
66 0.15
67 0.14
68 0.14
69 0.13
70 0.14
71 0.18
72 0.18
73 0.19
74 0.22
75 0.3
76 0.35
77 0.44
78 0.51
79 0.52
80 0.53
81 0.54
82 0.51
83 0.48
84 0.46
85 0.44
86 0.39
87 0.34
88 0.35
89 0.33
90 0.3
91 0.25
92 0.21
93 0.15
94 0.13
95 0.14
96 0.14
97 0.15
98 0.15
99 0.14
100 0.16
101 0.16
102 0.18
103 0.2
104 0.23
105 0.25
106 0.24
107 0.25
108 0.23
109 0.23
110 0.23
111 0.24
112 0.21
113 0.2
114 0.23
115 0.24
116 0.26
117 0.25
118 0.23
119 0.23
120 0.24
121 0.22
122 0.19
123 0.16
124 0.13
125 0.13
126 0.12
127 0.08
128 0.11
129 0.11
130 0.11
131 0.13
132 0.13
133 0.12
134 0.13
135 0.16
136 0.15
137 0.16
138 0.16
139 0.15
140 0.15
141 0.15
142 0.14
143 0.1
144 0.08
145 0.09
146 0.11
147 0.1
148 0.1
149 0.11
150 0.11
151 0.13
152 0.12
153 0.1
154 0.11
155 0.1
156 0.1
157 0.09
158 0.09
159 0.07
160 0.07
161 0.07
162 0.07
163 0.08
164 0.1
165 0.11
166 0.15
167 0.18
168 0.19
169 0.27
170 0.33
171 0.41
172 0.44
173 0.45
174 0.48
175 0.46
176 0.44
177 0.38
178 0.33
179 0.25
180 0.23
181 0.22
182 0.16
183 0.16
184 0.16
185 0.15
186 0.1
187 0.1
188 0.08
189 0.07
190 0.07
191 0.09
192 0.11
193 0.1
194 0.11
195 0.13
196 0.18
197 0.27
198 0.29
199 0.26
200 0.26
201 0.27
202 0.27
203 0.31
204 0.28
205 0.27
206 0.28
207 0.31
208 0.34
209 0.4
210 0.46
211 0.47
212 0.48
213 0.46
214 0.51
215 0.53
216 0.51
217 0.45
218 0.42
219 0.37
220 0.4
221 0.36
222 0.29
223 0.24
224 0.22
225 0.21
226 0.17
227 0.21
228 0.16
229 0.18
230 0.19
231 0.25
232 0.25
233 0.26
234 0.28
235 0.25
236 0.31
237 0.33
238 0.37
239 0.35
240 0.41
241 0.4
242 0.4
243 0.38
244 0.34
245 0.34
246 0.29
247 0.27
248 0.21
249 0.22
250 0.2
251 0.19
252 0.14
253 0.1
254 0.09
255 0.08
256 0.07
257 0.06
258 0.07
259 0.08
260 0.13
261 0.14
262 0.19
263 0.24
264 0.33
265 0.42
266 0.5
267 0.54
268 0.54
269 0.61
270 0.61
271 0.63
272 0.62
273 0.58
274 0.5
275 0.48
276 0.43
277 0.35
278 0.3
279 0.26
280 0.2
281 0.16
282 0.18
283 0.22
284 0.28
285 0.36
286 0.42
287 0.45
288 0.52
289 0.59
290 0.64
291 0.66
292 0.69
293 0.71
294 0.73
295 0.74
296 0.69
297 0.61
298 0.52
299 0.45
300 0.37
301 0.31
302 0.27
303 0.23
304 0.32
305 0.4
306 0.48
307 0.53
308 0.59
309 0.65
310 0.69
311 0.76
312 0.76
313 0.78
314 0.78
315 0.8
316 0.83
317 0.83
318 0.77