Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4ZA15

Protein Details
Accession A0A0F4ZA15    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPAAKKQKKKWSKGKVKDKAQHAVMHydrophilic
NLS Segment(s)
PositionSequence
5-20AKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAKKQKKKWSKGKVKDKAQHAVMLEKNVSEKLHKDVQSYRLVTVATLVDRMKINGSLARRCLKSLEEEGLIKPVVTHSKMQIYTRVISASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.93
4 0.93
5 0.9
6 0.86
7 0.82
8 0.73
9 0.66
10 0.56
11 0.52
12 0.43
13 0.38
14 0.31
15 0.24
16 0.23
17 0.2
18 0.19
19 0.14
20 0.14
21 0.16
22 0.23
23 0.24
24 0.26
25 0.28
26 0.33
27 0.38
28 0.37
29 0.33
30 0.27
31 0.25
32 0.22
33 0.19
34 0.14
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.15
46 0.17
47 0.21
48 0.26
49 0.25
50 0.26
51 0.26
52 0.25
53 0.26
54 0.27
55 0.26
56 0.23
57 0.24
58 0.24
59 0.24
60 0.23
61 0.18
62 0.14
63 0.14
64 0.17
65 0.18
66 0.2
67 0.21
68 0.29
69 0.33
70 0.34
71 0.38
72 0.37
73 0.36
74 0.36