Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZDF2

Protein Details
Accession A0A0F4ZDF2    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-31DLNSRPPRKTWSPNPWKTRLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, plas 4, E.R. 2, golg 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13409  GST_N_2  
PROSITE View protein in PROSITE  
PS50404  GST_NTER  
CDD cd03038  GST_N_etherase_LigE  
Amino Acid Sequences MTSTGKVTLFDLNSRPPRKTWSPNPWKTRLILNYKGIDYETEFLEYPEVKPRLEAHLPPGNDPHYPAPTYTIPTVKFPDGTYLMDSRVIATELEKRYPSRSLHLDSPYLPRLEALVSVLMSALCPVFIPTVPQAFLNDVSREYWERTRSAMFGMPCAELGRTKGGDAMWAAVAPDMQKVTALLQETDGVFFAGGEPGYADFVWVAFLLFFKGMGDDIWRNLMKAAGDEEPHLKLLEACKEWTARDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.42
4 0.49
5 0.54
6 0.6
7 0.61
8 0.63
9 0.71
10 0.78
11 0.85
12 0.83
13 0.78
14 0.7
15 0.68
16 0.65
17 0.62
18 0.6
19 0.58
20 0.56
21 0.52
22 0.51
23 0.43
24 0.35
25 0.29
26 0.23
27 0.17
28 0.15
29 0.15
30 0.14
31 0.16
32 0.15
33 0.14
34 0.22
35 0.22
36 0.2
37 0.22
38 0.23
39 0.28
40 0.32
41 0.32
42 0.29
43 0.35
44 0.36
45 0.35
46 0.37
47 0.32
48 0.28
49 0.29
50 0.26
51 0.23
52 0.23
53 0.22
54 0.23
55 0.22
56 0.25
57 0.24
58 0.25
59 0.22
60 0.25
61 0.28
62 0.24
63 0.24
64 0.21
65 0.23
66 0.21
67 0.21
68 0.2
69 0.18
70 0.18
71 0.17
72 0.17
73 0.13
74 0.11
75 0.11
76 0.08
77 0.09
78 0.15
79 0.16
80 0.18
81 0.19
82 0.19
83 0.21
84 0.26
85 0.26
86 0.24
87 0.27
88 0.29
89 0.33
90 0.34
91 0.33
92 0.3
93 0.33
94 0.31
95 0.26
96 0.22
97 0.17
98 0.15
99 0.13
100 0.12
101 0.08
102 0.06
103 0.05
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.04
115 0.06
116 0.07
117 0.08
118 0.08
119 0.09
120 0.09
121 0.1
122 0.11
123 0.11
124 0.11
125 0.11
126 0.11
127 0.12
128 0.13
129 0.15
130 0.18
131 0.18
132 0.18
133 0.19
134 0.2
135 0.19
136 0.19
137 0.2
138 0.16
139 0.15
140 0.16
141 0.14
142 0.14
143 0.14
144 0.12
145 0.09
146 0.1
147 0.12
148 0.11
149 0.11
150 0.12
151 0.11
152 0.12
153 0.12
154 0.12
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.07
162 0.06
163 0.06
164 0.06
165 0.06
166 0.07
167 0.09
168 0.1
169 0.09
170 0.1
171 0.12
172 0.12
173 0.12
174 0.11
175 0.09
176 0.07
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.05
183 0.06
184 0.07
185 0.07
186 0.07
187 0.05
188 0.06
189 0.06
190 0.06
191 0.06
192 0.04
193 0.05
194 0.06
195 0.06
196 0.06
197 0.05
198 0.06
199 0.06
200 0.07
201 0.11
202 0.12
203 0.13
204 0.19
205 0.19
206 0.19
207 0.19
208 0.21
209 0.17
210 0.17
211 0.19
212 0.16
213 0.17
214 0.19
215 0.21
216 0.21
217 0.21
218 0.2
219 0.17
220 0.16
221 0.2
222 0.26
223 0.26
224 0.26
225 0.29
226 0.31
227 0.31