Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZFY4

Protein Details
Accession A0A0F4ZFY4   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-46KKGASAKCSKPKKMKTSHDKLQRKFBasic
NLS Segment(s)
PositionSequence
7-45KKSTARPGPKANKASKKGASAKCSKPKKMKTSHDKLQRK
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGSIKKSTARPGPKANKASKKGASAKCSKPKKMKTSHDKLQRKFAGALVAKTEKLLGERVGHLEMIGKGKKTAPEDRLNAKGGTKKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.77
4 0.78
5 0.79
6 0.76
7 0.77
8 0.71
9 0.7
10 0.7
11 0.68
12 0.65
13 0.63
14 0.67
15 0.69
16 0.72
17 0.72
18 0.72
19 0.75
20 0.77
21 0.79
22 0.8
23 0.81
24 0.82
25 0.82
26 0.83
27 0.83
28 0.75
29 0.75
30 0.67
31 0.59
32 0.5
33 0.43
34 0.39
35 0.31
36 0.3
37 0.24
38 0.23
39 0.2
40 0.19
41 0.19
42 0.11
43 0.11
44 0.12
45 0.1
46 0.11
47 0.12
48 0.14
49 0.14
50 0.14
51 0.13
52 0.14
53 0.14
54 0.18
55 0.18
56 0.17
57 0.18
58 0.21
59 0.25
60 0.29
61 0.35
62 0.36
63 0.43
64 0.48
65 0.53
66 0.56
67 0.54
68 0.5
69 0.46
70 0.46