Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZCF1

Protein Details
Accession A0A0F4ZCF1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
292-314GEPDDRNVQKRRKKTLGNMSNSGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF08633  Rox3  
Amino Acid Sequences MSCHPQTPQSPSQLSAGQSDSCLSMPGSNNAIPTPAHSVNGGNSQQEPVMDGSLLKRKRPLDDAGDHMVKRLHTAAGSLGIEALHQDVGNKYRLLKAPIVAPKYRPCDDFFTMFNLEGLASDLAREKPNGEKNILRKSFKNQLKRLNIGGGYDTKKDQVEENDSESLLSLVRMPDDVWYANVVKEKDITQGIPPYVSAALTKVPALSRGKMRKEAWDSYVLGSYESGAGVHSESAPCSTPNTPGASGAGSRLRQTLDASKSRRGLKKRSYLETGFEDGHGDDETADGGYSTGEPDDRNVQKRRKKTLGNMSNSGNVRRQAYGPATGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.32
4 0.25
5 0.23
6 0.22
7 0.2
8 0.16
9 0.16
10 0.13
11 0.15
12 0.17
13 0.2
14 0.23
15 0.23
16 0.24
17 0.23
18 0.24
19 0.19
20 0.19
21 0.23
22 0.2
23 0.2
24 0.2
25 0.21
26 0.22
27 0.3
28 0.28
29 0.22
30 0.22
31 0.22
32 0.22
33 0.21
34 0.2
35 0.13
36 0.13
37 0.11
38 0.11
39 0.14
40 0.22
41 0.24
42 0.24
43 0.3
44 0.32
45 0.36
46 0.41
47 0.43
48 0.42
49 0.45
50 0.48
51 0.49
52 0.5
53 0.46
54 0.42
55 0.38
56 0.3
57 0.27
58 0.23
59 0.17
60 0.12
61 0.13
62 0.13
63 0.15
64 0.15
65 0.13
66 0.11
67 0.1
68 0.1
69 0.09
70 0.09
71 0.05
72 0.05
73 0.06
74 0.08
75 0.11
76 0.14
77 0.14
78 0.14
79 0.2
80 0.23
81 0.26
82 0.26
83 0.25
84 0.29
85 0.35
86 0.39
87 0.35
88 0.36
89 0.39
90 0.43
91 0.44
92 0.39
93 0.36
94 0.38
95 0.39
96 0.37
97 0.31
98 0.3
99 0.28
100 0.26
101 0.23
102 0.16
103 0.13
104 0.11
105 0.11
106 0.07
107 0.05
108 0.06
109 0.08
110 0.09
111 0.1
112 0.1
113 0.1
114 0.17
115 0.24
116 0.26
117 0.27
118 0.3
119 0.36
120 0.46
121 0.5
122 0.45
123 0.41
124 0.44
125 0.51
126 0.54
127 0.57
128 0.53
129 0.58
130 0.62
131 0.63
132 0.58
133 0.51
134 0.45
135 0.35
136 0.3
137 0.25
138 0.21
139 0.19
140 0.18
141 0.16
142 0.16
143 0.16
144 0.16
145 0.15
146 0.19
147 0.19
148 0.21
149 0.21
150 0.2
151 0.19
152 0.17
153 0.14
154 0.08
155 0.07
156 0.05
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.07
164 0.07
165 0.08
166 0.09
167 0.1
168 0.13
169 0.13
170 0.12
171 0.13
172 0.13
173 0.14
174 0.15
175 0.14
176 0.13
177 0.16
178 0.16
179 0.15
180 0.14
181 0.12
182 0.11
183 0.11
184 0.09
185 0.06
186 0.07
187 0.07
188 0.08
189 0.07
190 0.07
191 0.13
192 0.15
193 0.17
194 0.24
195 0.32
196 0.35
197 0.42
198 0.43
199 0.46
200 0.5
201 0.51
202 0.46
203 0.42
204 0.4
205 0.34
206 0.36
207 0.27
208 0.21
209 0.18
210 0.15
211 0.11
212 0.09
213 0.08
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.08
222 0.09
223 0.09
224 0.12
225 0.12
226 0.15
227 0.18
228 0.21
229 0.2
230 0.19
231 0.2
232 0.18
233 0.17
234 0.17
235 0.19
236 0.16
237 0.17
238 0.18
239 0.18
240 0.18
241 0.21
242 0.26
243 0.28
244 0.35
245 0.38
246 0.43
247 0.48
248 0.56
249 0.6
250 0.6
251 0.63
252 0.64
253 0.71
254 0.72
255 0.73
256 0.72
257 0.67
258 0.65
259 0.59
260 0.53
261 0.43
262 0.35
263 0.3
264 0.22
265 0.21
266 0.17
267 0.12
268 0.08
269 0.08
270 0.08
271 0.07
272 0.06
273 0.05
274 0.05
275 0.05
276 0.05
277 0.06
278 0.06
279 0.07
280 0.08
281 0.11
282 0.2
283 0.26
284 0.34
285 0.43
286 0.52
287 0.6
288 0.69
289 0.77
290 0.77
291 0.79
292 0.82
293 0.84
294 0.84
295 0.83
296 0.79
297 0.72
298 0.7
299 0.64
300 0.58
301 0.52
302 0.45
303 0.4
304 0.37
305 0.35
306 0.35
307 0.36