Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZJZ1

Protein Details
Accession A0A0F4ZJZ1   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MVKKRKNNGRNKKGRGHTKPIRCSNCSHydrophilic
81-111GKIVRVRSRSGRRNRAPPPRVRYNKDGKKIVBasic
NLS Segment(s)
PositionSequence
3-19KKRKNNGRNKKGRGHTK
85-109RVRSRSGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MVKKRKNNGRNKKGRGHTKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSRSGRRNRAPPPRVRYNKDGKKIVPTQAGKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.88
3 0.87
4 0.85
5 0.85
6 0.86
7 0.86
8 0.84
9 0.77
10 0.77
11 0.76
12 0.76
13 0.74
14 0.71
15 0.68
16 0.69
17 0.71
18 0.7
19 0.71
20 0.7
21 0.72
22 0.73
23 0.75
24 0.71
25 0.72
26 0.67
27 0.67
28 0.59
29 0.52
30 0.45
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.06
48 0.05
49 0.06
50 0.07
51 0.07
52 0.07
53 0.08
54 0.11
55 0.17
56 0.19
57 0.2
58 0.23
59 0.24
60 0.25
61 0.27
62 0.25
63 0.2
64 0.2
65 0.18
66 0.2
67 0.19
68 0.21
69 0.22
70 0.29
71 0.32
72 0.32
73 0.35
74 0.4
75 0.49
76 0.56
77 0.63
78 0.67
79 0.7
80 0.77
81 0.83
82 0.85
83 0.83
84 0.83
85 0.81
86 0.82
87 0.83
88 0.8
89 0.79
90 0.79
91 0.81
92 0.8
93 0.79
94 0.7
95 0.71
96 0.7
97 0.69
98 0.67
99 0.61