Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZKT9

Protein Details
Accession A0A0F4ZKT9    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
119-153REKADEEKTRRNREKREKMKARKAKAKSGKPPPLPBasic
NLS Segment(s)
PositionSequence
121-150KADEEKTRRNREKREKMKARKAKAKSGKPP
Subcellular Location(s) nucl 20.5, mito_nucl 12, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009548  Prkrip1  
Gene Ontology GO:0003725  F:double-stranded RNA binding  
Pfam View protein in Pfam  
PF06658  DUF1168  
Amino Acid Sequences MSAGGQDSIPASADPSTTRPAKRRMLTAVSAQSACLNALFSKPDTSIAIPPSSTPAVRALPPPPEIVTNVQGSSSGAGSGEFHVYKAARRREYERLRRMDEEVRGELADRQFALEKAQREKADEEKTRRNREKREKMKARKAKAKSGKPPPLPQQQQQPPLKQSGGIPKRAEITPEETKTNDNKTNEEEKQNRDAPTEEAAASAAAVGLIIHDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.2
4 0.25
5 0.31
6 0.37
7 0.44
8 0.53
9 0.55
10 0.58
11 0.59
12 0.59
13 0.57
14 0.57
15 0.54
16 0.48
17 0.44
18 0.38
19 0.32
20 0.26
21 0.23
22 0.16
23 0.11
24 0.08
25 0.1
26 0.12
27 0.12
28 0.14
29 0.14
30 0.16
31 0.16
32 0.18
33 0.21
34 0.21
35 0.21
36 0.19
37 0.19
38 0.21
39 0.2
40 0.18
41 0.15
42 0.16
43 0.17
44 0.19
45 0.21
46 0.2
47 0.22
48 0.24
49 0.24
50 0.21
51 0.21
52 0.21
53 0.21
54 0.22
55 0.19
56 0.18
57 0.16
58 0.15
59 0.14
60 0.13
61 0.1
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.09
68 0.08
69 0.08
70 0.1
71 0.1
72 0.13
73 0.21
74 0.27
75 0.29
76 0.32
77 0.37
78 0.46
79 0.56
80 0.63
81 0.64
82 0.62
83 0.62
84 0.61
85 0.59
86 0.54
87 0.46
88 0.4
89 0.31
90 0.26
91 0.22
92 0.21
93 0.2
94 0.15
95 0.12
96 0.08
97 0.08
98 0.08
99 0.09
100 0.11
101 0.12
102 0.15
103 0.18
104 0.24
105 0.23
106 0.25
107 0.27
108 0.31
109 0.36
110 0.4
111 0.42
112 0.48
113 0.56
114 0.64
115 0.7
116 0.71
117 0.73
118 0.78
119 0.83
120 0.83
121 0.86
122 0.87
123 0.88
124 0.92
125 0.9
126 0.88
127 0.86
128 0.81
129 0.8
130 0.79
131 0.79
132 0.78
133 0.8
134 0.8
135 0.77
136 0.79
137 0.77
138 0.77
139 0.73
140 0.68
141 0.68
142 0.66
143 0.7
144 0.68
145 0.66
146 0.58
147 0.57
148 0.53
149 0.43
150 0.39
151 0.41
152 0.4
153 0.41
154 0.39
155 0.36
156 0.4
157 0.39
158 0.37
159 0.29
160 0.31
161 0.32
162 0.34
163 0.35
164 0.32
165 0.36
166 0.39
167 0.43
168 0.43
169 0.37
170 0.37
171 0.42
172 0.5
173 0.5
174 0.56
175 0.54
176 0.53
177 0.59
178 0.61
179 0.56
180 0.5
181 0.46
182 0.39
183 0.37
184 0.34
185 0.25
186 0.2
187 0.19
188 0.16
189 0.14
190 0.11
191 0.07
192 0.04
193 0.04
194 0.03
195 0.03