Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZFN1

Protein Details
Accession A0A0F4ZFN1   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
150-174LEDVKDALRKKRKRKTKAGDDADGGBasic
NLS Segment(s)
PositionSequence
17-64NQAKEKAMRNKPPTGVVKAKKQKGTPPSSAPKTASGLVELLRKRNKKK
86-94KPKGKKKGK
139-167AEKKEAERKANLEDVKDALRKKRKRKTKA
Subcellular Location(s) nucl 15, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0051028  P:mRNA transport  
GO:0042273  P:ribosomal large subunit biogenesis  
Amino Acid Sequences MGRTATIKNKAALNKANQAKEKAMRNKPPTGVVKAKKQKGTPPSSAPKTASGLVELLRKRNKKKVYSEKELDLPALNKITPIGVVKPKGKKKGKVFVDDKESMATILAMVQAEKEGQIESKIMKARQLEEVREARRVEAEKKEAERKANLEDVKDALRKKRKRKTKAGDDADGGASVKQLALAGTKAGKAKRVAFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.61
4 0.6
5 0.59
6 0.58
7 0.57
8 0.61
9 0.62
10 0.64
11 0.67
12 0.69
13 0.72
14 0.68
15 0.7
16 0.66
17 0.63
18 0.63
19 0.59
20 0.63
21 0.66
22 0.71
23 0.68
24 0.67
25 0.67
26 0.67
27 0.69
28 0.64
29 0.64
30 0.66
31 0.64
32 0.65
33 0.59
34 0.52
35 0.47
36 0.42
37 0.34
38 0.25
39 0.21
40 0.19
41 0.23
42 0.21
43 0.25
44 0.31
45 0.37
46 0.41
47 0.49
48 0.56
49 0.58
50 0.68
51 0.72
52 0.74
53 0.77
54 0.76
55 0.7
56 0.65
57 0.57
58 0.47
59 0.37
60 0.29
61 0.21
62 0.17
63 0.14
64 0.1
65 0.1
66 0.09
67 0.08
68 0.08
69 0.1
70 0.13
71 0.17
72 0.22
73 0.31
74 0.37
75 0.46
76 0.51
77 0.56
78 0.6
79 0.66
80 0.66
81 0.68
82 0.65
83 0.6
84 0.61
85 0.54
86 0.46
87 0.37
88 0.31
89 0.21
90 0.18
91 0.13
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.05
105 0.06
106 0.06
107 0.11
108 0.14
109 0.14
110 0.17
111 0.19
112 0.2
113 0.28
114 0.31
115 0.29
116 0.32
117 0.38
118 0.37
119 0.4
120 0.38
121 0.3
122 0.31
123 0.32
124 0.3
125 0.31
126 0.33
127 0.34
128 0.39
129 0.46
130 0.45
131 0.46
132 0.45
133 0.41
134 0.41
135 0.43
136 0.39
137 0.33
138 0.31
139 0.29
140 0.3
141 0.31
142 0.3
143 0.33
144 0.42
145 0.49
146 0.58
147 0.67
148 0.73
149 0.79
150 0.87
151 0.89
152 0.9
153 0.92
154 0.89
155 0.84
156 0.75
157 0.68
158 0.57
159 0.47
160 0.36
161 0.25
162 0.17
163 0.12
164 0.09
165 0.07
166 0.06
167 0.06
168 0.07
169 0.08
170 0.1
171 0.12
172 0.15
173 0.2
174 0.21
175 0.26
176 0.29