Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F4ZCI5

Protein Details
Accession A0A0F4ZCI5    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-43RKDASSARIKRNKKQQQVKFKVRCQRFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKQFLEICRRKDASSARIKRNKKQQQVKFKVRCQRFLYTLSLKDLEKAEKLKQSLPPSTTPPSLQPTRLPADAALNITDLSKKEKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.41
3 0.42
4 0.37
5 0.43
6 0.49
7 0.47
8 0.53
9 0.58
10 0.6
11 0.68
12 0.72
13 0.74
14 0.78
15 0.79
16 0.79
17 0.8
18 0.79
19 0.82
20 0.87
21 0.89
22 0.87
23 0.84
24 0.83
25 0.76
26 0.74
27 0.68
28 0.62
29 0.54
30 0.49
31 0.47
32 0.41
33 0.39
34 0.33
35 0.29
36 0.24
37 0.23
38 0.22
39 0.17
40 0.16
41 0.18
42 0.19
43 0.22
44 0.24
45 0.26
46 0.3
47 0.34
48 0.37
49 0.37
50 0.37
51 0.37
52 0.4
53 0.39
54 0.34
55 0.32
56 0.34
57 0.34
58 0.34
59 0.32
60 0.33
61 0.36
62 0.35
63 0.32
64 0.26
65 0.28
66 0.27
67 0.26
68 0.21
69 0.17
70 0.16
71 0.16
72 0.17
73 0.14