Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZAE7

Protein Details
Accession A0A0F4ZAE7   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
75-104KPTASKASSSKRIQKKRKAKKSSIVFKTFKHydrophilic
NLS Segment(s)
PositionSequence
80-111KASSSKRIQKKRKAKKSSIVFKTFKERTRGKK
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MARSARSSALKVNNQKLKSKVFGPVEAARTERLSAKLLELAKAPKPIHDVKMDEAAEDAEEKKADDVMEIDGAAKPTASKASSSKRIQKKRKAKKSSIVFKTFKERTRGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.66
3 0.64
4 0.6
5 0.55
6 0.49
7 0.48
8 0.44
9 0.43
10 0.42
11 0.42
12 0.39
13 0.37
14 0.35
15 0.28
16 0.25
17 0.24
18 0.21
19 0.18
20 0.17
21 0.16
22 0.16
23 0.19
24 0.18
25 0.18
26 0.18
27 0.19
28 0.19
29 0.25
30 0.23
31 0.2
32 0.25
33 0.27
34 0.28
35 0.28
36 0.28
37 0.23
38 0.3
39 0.28
40 0.23
41 0.21
42 0.18
43 0.14
44 0.13
45 0.12
46 0.05
47 0.05
48 0.06
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.09
65 0.09
66 0.11
67 0.16
68 0.24
69 0.34
70 0.41
71 0.5
72 0.57
73 0.68
74 0.76
75 0.81
76 0.84
77 0.86
78 0.91
79 0.92
80 0.9
81 0.9
82 0.9
83 0.9
84 0.89
85 0.87
86 0.79
87 0.73
88 0.74
89 0.71
90 0.66
91 0.64