Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZEE8

Protein Details
Accession A0A0F4ZEE8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRERMRAVDSVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRVTNPLSSGLLWKIPWRLSKFQKRRHRERMRAVDSVVDTLSAAMAKQGQTVAALEHWKENMPTEEQMQARDKYTMFDRKVKGYRKGIHTELPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.2
5 0.22
6 0.25
7 0.32
8 0.35
9 0.42
10 0.5
11 0.6
12 0.67
13 0.73
14 0.8
15 0.82
16 0.87
17 0.9
18 0.9
19 0.89
20 0.9
21 0.9
22 0.86
23 0.78
24 0.68
25 0.6
26 0.49
27 0.4
28 0.29
29 0.18
30 0.12
31 0.09
32 0.09
33 0.05
34 0.04
35 0.03
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.08
50 0.08
51 0.1
52 0.1
53 0.12
54 0.12
55 0.13
56 0.18
57 0.18
58 0.21
59 0.24
60 0.23
61 0.22
62 0.23
63 0.21
64 0.19
65 0.25
66 0.3
67 0.3
68 0.37
69 0.38
70 0.44
71 0.52
72 0.57
73 0.6
74 0.61
75 0.65
76 0.64
77 0.69
78 0.64
79 0.64
80 0.63
81 0.59
82 0.6
83 0.56
84 0.52
85 0.49
86 0.51
87 0.52
88 0.53
89 0.58
90 0.56
91 0.64