Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F4ZB92

Protein Details
Accession A0A0F4ZB92    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-95HSSVKKRCEHCKIVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MVASLLCSLRALSLRVPRATLAVSGALVAQGVRALSTAALAGSSVRNGAAKGMVVAAVQQVQQTRGMKVHSSVKKRCEHCKIVRRKAGKRHNGYLYVICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.3
5 0.3
6 0.29
7 0.24
8 0.17
9 0.12
10 0.11
11 0.1
12 0.09
13 0.08
14 0.07
15 0.06
16 0.04
17 0.04
18 0.04
19 0.03
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.06
48 0.07
49 0.11
50 0.12
51 0.13
52 0.14
53 0.15
54 0.15
55 0.17
56 0.26
57 0.29
58 0.37
59 0.41
60 0.47
61 0.54
62 0.58
63 0.64
64 0.64
65 0.66
66 0.68
67 0.73
68 0.76
69 0.78
70 0.82
71 0.82
72 0.82
73 0.83
74 0.84
75 0.84
76 0.81
77 0.79
78 0.78
79 0.73
80 0.68
81 0.65
82 0.57
83 0.5
84 0.43
85 0.36
86 0.36
87 0.39
88 0.46
89 0.49
90 0.55