Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NPV3

Protein Details
Accession A0A0E9NPV3    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
65-85VETKGRKRPLREKLICKERRVBasic
NLS Segment(s)
PositionSequence
68-103KGRKRPLREKLICKERRVVIEGKDRSSRSIKFKRRR
Subcellular Location(s) mito 17, nucl 5, cyto 3
Family & Domain DBs
Amino Acid Sequences MIKRRIITGTKTSIHPRTAQHHTSSVVLKAVHGIRIIALSAIAGGSATGEAGAAGRCRTGSIAAVETKGRKRPLREKLICKERRVVIEGKDRSSRSIKFKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.45
4 0.45
5 0.5
6 0.49
7 0.45
8 0.43
9 0.42
10 0.4
11 0.37
12 0.31
13 0.26
14 0.21
15 0.18
16 0.19
17 0.18
18 0.17
19 0.15
20 0.14
21 0.11
22 0.11
23 0.11
24 0.07
25 0.06
26 0.04
27 0.04
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.02
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.06
47 0.07
48 0.08
49 0.1
50 0.11
51 0.12
52 0.14
53 0.17
54 0.2
55 0.24
56 0.29
57 0.32
58 0.39
59 0.48
60 0.57
61 0.64
62 0.69
63 0.73
64 0.77
65 0.84
66 0.82
67 0.76
68 0.73
69 0.67
70 0.62
71 0.57
72 0.51
73 0.47
74 0.51
75 0.52
76 0.5
77 0.52
78 0.48
79 0.49
80 0.51
81 0.5
82 0.5
83 0.57