Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NF75

Protein Details
Accession A0A0E9NF75    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-62IPNHTAKSQKPKPEKPKTIKPENAQHydrophilic
NLS Segment(s)
PositionSequence
44-54KSQKPKPEKPK
Subcellular Location(s) mito 14, nucl 10, plas 2
Family & Domain DBs
Amino Acid Sequences MFVLLVNAGKAMRTICYPAYICPYHKRYQGQSRSEPKIPNHTAKSQKPKPEKPKTIKPENAQDNVHASPLSYNGPNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.17
4 0.18
5 0.19
6 0.25
7 0.26
8 0.28
9 0.33
10 0.38
11 0.38
12 0.43
13 0.46
14 0.47
15 0.55
16 0.61
17 0.6
18 0.63
19 0.66
20 0.66
21 0.66
22 0.62
23 0.54
24 0.54
25 0.51
26 0.48
27 0.44
28 0.46
29 0.5
30 0.53
31 0.61
32 0.58
33 0.63
34 0.67
35 0.73
36 0.77
37 0.8
38 0.83
39 0.81
40 0.85
41 0.85
42 0.86
43 0.84
44 0.79
45 0.78
46 0.75
47 0.72
48 0.62
49 0.55
50 0.5
51 0.42
52 0.37
53 0.27
54 0.2
55 0.16
56 0.17
57 0.19