Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NPN1

Protein Details
Accession A0A0E9NPN1   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
106-126NKVHLIQLRKKHKPNPSHTNTHydrophilic
NLS Segment(s)
PositionSequence
113-122LRKKHKPNPS
129-132KERG
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MVYQSQKLLYSSRANILHVRTCFVVLMPSPVEKLVEVTLVETKINRRVALDSLHLKVRHKQDLTIRDTWRNFLPIRRWDRYRNRSKSENVVMEQQRGRSSSRSRSNKVHLIQLRKKHKPNPSHTNTGSKERGKNPTQRRST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.41
5 0.35
6 0.35
7 0.28
8 0.27
9 0.25
10 0.21
11 0.19
12 0.13
13 0.16
14 0.14
15 0.14
16 0.14
17 0.14
18 0.14
19 0.11
20 0.13
21 0.1
22 0.09
23 0.09
24 0.09
25 0.11
26 0.12
27 0.12
28 0.11
29 0.13
30 0.19
31 0.21
32 0.2
33 0.19
34 0.2
35 0.22
36 0.23
37 0.25
38 0.22
39 0.22
40 0.27
41 0.27
42 0.26
43 0.3
44 0.34
45 0.36
46 0.33
47 0.35
48 0.38
49 0.45
50 0.49
51 0.5
52 0.46
53 0.44
54 0.44
55 0.42
56 0.36
57 0.31
58 0.26
59 0.23
60 0.28
61 0.31
62 0.37
63 0.4
64 0.43
65 0.5
66 0.6
67 0.66
68 0.7
69 0.7
70 0.69
71 0.7
72 0.69
73 0.68
74 0.64
75 0.58
76 0.49
77 0.49
78 0.45
79 0.44
80 0.42
81 0.36
82 0.3
83 0.27
84 0.28
85 0.25
86 0.3
87 0.35
88 0.44
89 0.5
90 0.54
91 0.6
92 0.65
93 0.67
94 0.64
95 0.64
96 0.59
97 0.61
98 0.64
99 0.66
100 0.7
101 0.71
102 0.77
103 0.75
104 0.78
105 0.78
106 0.8
107 0.82
108 0.79
109 0.79
110 0.75
111 0.77
112 0.72
113 0.7
114 0.68
115 0.64
116 0.65
117 0.62
118 0.67
119 0.65
120 0.71
121 0.73