Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KB16

Protein Details
Accession Q5KB16    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
213-233AEEEKKRKRAEKFGSNKPPVVBasic
NLS Segment(s)
PositionSequence
176-201KRAAKFGLPEKKEAGKPASKPEKKAE
210-224KLAAEEEKKRKRAEK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003034  SAP_dom  
IPR036361  SAP_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0016973  P:poly(A)+ mRNA export from nucleus  
Pfam View protein in Pfam  
PF02037  SAP  
PROSITE View protein in PROSITE  
PS50800  SAP  
Amino Acid Sequences MEARLQKLKVTDLKELLAKYHLPQTGKKDDLVKRLLENNISYEEPQEELIDPDAPISGTNVPKTIPQVTTAPAAPDTSLIDPPRTSDASASELPAAETNDILAPAPSTEPEVELTPDQKAMKARAERFGIPFNLPKPSATKPAKTEKAESKPAETREKAASINKDSLGLSDDILAKRAAKFGLPEKKEAGKPASKPEKKAEEVDPELAAKLAAEEEKKRKRAEKFGSNKPPVVEETEGQNAASEPDTKKVKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.35
4 0.32
5 0.28
6 0.24
7 0.29
8 0.3
9 0.29
10 0.33
11 0.4
12 0.46
13 0.46
14 0.47
15 0.48
16 0.5
17 0.56
18 0.54
19 0.49
20 0.44
21 0.47
22 0.48
23 0.42
24 0.38
25 0.32
26 0.31
27 0.3
28 0.26
29 0.22
30 0.2
31 0.17
32 0.16
33 0.15
34 0.12
35 0.12
36 0.13
37 0.12
38 0.11
39 0.1
40 0.1
41 0.09
42 0.08
43 0.09
44 0.12
45 0.13
46 0.14
47 0.15
48 0.15
49 0.17
50 0.2
51 0.22
52 0.18
53 0.18
54 0.19
55 0.2
56 0.22
57 0.21
58 0.19
59 0.16
60 0.15
61 0.13
62 0.12
63 0.12
64 0.11
65 0.14
66 0.14
67 0.15
68 0.14
69 0.16
70 0.19
71 0.18
72 0.16
73 0.14
74 0.15
75 0.18
76 0.18
77 0.18
78 0.14
79 0.13
80 0.13
81 0.14
82 0.12
83 0.08
84 0.07
85 0.07
86 0.06
87 0.07
88 0.06
89 0.05
90 0.04
91 0.04
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.08
99 0.09
100 0.09
101 0.1
102 0.09
103 0.11
104 0.11
105 0.12
106 0.13
107 0.14
108 0.19
109 0.24
110 0.26
111 0.29
112 0.31
113 0.3
114 0.31
115 0.31
116 0.27
117 0.23
118 0.24
119 0.19
120 0.2
121 0.19
122 0.18
123 0.19
124 0.2
125 0.28
126 0.29
127 0.32
128 0.34
129 0.43
130 0.49
131 0.48
132 0.51
133 0.49
134 0.53
135 0.57
136 0.53
137 0.49
138 0.47
139 0.49
140 0.51
141 0.43
142 0.4
143 0.34
144 0.35
145 0.32
146 0.32
147 0.32
148 0.28
149 0.3
150 0.27
151 0.26
152 0.24
153 0.22
154 0.19
155 0.15
156 0.11
157 0.11
158 0.14
159 0.13
160 0.14
161 0.14
162 0.13
163 0.13
164 0.14
165 0.12
166 0.1
167 0.13
168 0.21
169 0.31
170 0.31
171 0.34
172 0.36
173 0.41
174 0.42
175 0.43
176 0.41
177 0.38
178 0.39
179 0.47
180 0.54
181 0.53
182 0.55
183 0.59
184 0.61
185 0.58
186 0.6
187 0.55
188 0.52
189 0.52
190 0.49
191 0.42
192 0.34
193 0.3
194 0.26
195 0.2
196 0.11
197 0.08
198 0.07
199 0.09
200 0.12
201 0.18
202 0.29
203 0.38
204 0.44
205 0.49
206 0.55
207 0.61
208 0.68
209 0.71
210 0.72
211 0.72
212 0.78
213 0.84
214 0.81
215 0.76
216 0.67
217 0.6
218 0.51
219 0.48
220 0.4
221 0.3
222 0.31
223 0.32
224 0.31
225 0.28
226 0.27
227 0.21
228 0.19
229 0.2
230 0.19
231 0.16
232 0.23