Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KA03

Protein Details
Accession Q5KA03    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MLSLKESKKSKPSKEHPAATKAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, cyto_mito 11.833, cyto 8, cyto_nucl 5.833, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
Gene Ontology GO:0008126  F:acetylesterase activity  
GO:0047372  F:acylglycerol lipase activity  
GO:0051792  P:medium-chain fatty acid biosynthetic process  
GO:0051793  P:medium-chain fatty acid catabolic process  
KEGG cne:CNK00080  -  
Pfam View protein in Pfam  
PF00561  Abhydrolase_1  
Amino Acid Sequences MLSLKESKKSKPSKEHPAATKAQGTTFSAILSAIYYYTLGALFSNISNSVYSLVGSLGMARWARDIVRIVPSKPGIVKLRSSLGSGGAKTGKGNKNLTEWINESVPSLMGRFTPAAWLPNGHLQTLFTAAGDFTKVDKVHYIRTYLRLPDGGTLGIDATPENHDGLPADAPTVVVCHGLTGGSHESYVRNILAWVAKPKEDGGLGGRGVVVNFRGCAGVPVTSCQLYSAGTTMDLALALHFIRNRHPSSPLIGIGFSLGASIISRYLGEYGYSSILSAGVVLGCPWDLTAMSHKLENDWFTARVYSSTLGRNVLRLFFKAFDQNPAVFEAPDSPIREYIEELKAERKNQGTQSRLRRIDDLLVSKIGGPRGIGAWPFPSAKEYYDWASSTHVLRNVKVPLFAINAFDDPVVDGGALPLDEFVASSHIYTAVTGGGGHLGWFDGPFFDKTKSKQRWVLKPVSEFISACTRDLSPPDEDPDSRVDIVAGSRIGPKGADVKLGAEANGNADFKSNIDADVELNADGGWEWVVNPKYKIPGFEKVGWKVLKEGEVVEGESDEGEGGLVQGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.85
4 0.83
5 0.79
6 0.73
7 0.7
8 0.6
9 0.52
10 0.46
11 0.41
12 0.36
13 0.3
14 0.24
15 0.18
16 0.16
17 0.14
18 0.12
19 0.09
20 0.06
21 0.07
22 0.07
23 0.06
24 0.07
25 0.07
26 0.06
27 0.06
28 0.07
29 0.08
30 0.08
31 0.1
32 0.1
33 0.11
34 0.11
35 0.11
36 0.12
37 0.11
38 0.11
39 0.09
40 0.09
41 0.08
42 0.08
43 0.08
44 0.07
45 0.11
46 0.11
47 0.11
48 0.12
49 0.13
50 0.14
51 0.17
52 0.2
53 0.19
54 0.27
55 0.31
56 0.3
57 0.36
58 0.37
59 0.37
60 0.35
61 0.39
62 0.37
63 0.37
64 0.39
65 0.36
66 0.4
67 0.37
68 0.37
69 0.31
70 0.3
71 0.3
72 0.27
73 0.28
74 0.24
75 0.23
76 0.24
77 0.33
78 0.33
79 0.36
80 0.4
81 0.38
82 0.41
83 0.46
84 0.46
85 0.41
86 0.38
87 0.35
88 0.32
89 0.29
90 0.25
91 0.2
92 0.19
93 0.14
94 0.12
95 0.1
96 0.09
97 0.11
98 0.1
99 0.1
100 0.13
101 0.14
102 0.16
103 0.16
104 0.17
105 0.17
106 0.23
107 0.24
108 0.21
109 0.2
110 0.18
111 0.18
112 0.2
113 0.17
114 0.1
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.07
121 0.12
122 0.12
123 0.13
124 0.19
125 0.2
126 0.27
127 0.29
128 0.33
129 0.31
130 0.36
131 0.39
132 0.35
133 0.35
134 0.29
135 0.28
136 0.25
137 0.23
138 0.18
139 0.14
140 0.12
141 0.1
142 0.09
143 0.08
144 0.06
145 0.06
146 0.08
147 0.08
148 0.09
149 0.09
150 0.09
151 0.09
152 0.1
153 0.1
154 0.08
155 0.08
156 0.07
157 0.07
158 0.07
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.08
168 0.09
169 0.09
170 0.09
171 0.1
172 0.1
173 0.11
174 0.13
175 0.1
176 0.08
177 0.08
178 0.1
179 0.11
180 0.13
181 0.17
182 0.17
183 0.18
184 0.18
185 0.19
186 0.18
187 0.16
188 0.15
189 0.12
190 0.13
191 0.13
192 0.12
193 0.12
194 0.11
195 0.1
196 0.1
197 0.08
198 0.06
199 0.06
200 0.06
201 0.06
202 0.06
203 0.07
204 0.08
205 0.09
206 0.09
207 0.1
208 0.11
209 0.11
210 0.11
211 0.1
212 0.1
213 0.08
214 0.08
215 0.08
216 0.06
217 0.06
218 0.06
219 0.06
220 0.05
221 0.05
222 0.04
223 0.03
224 0.04
225 0.04
226 0.05
227 0.06
228 0.07
229 0.12
230 0.17
231 0.2
232 0.2
233 0.23
234 0.23
235 0.25
236 0.27
237 0.24
238 0.19
239 0.17
240 0.15
241 0.13
242 0.11
243 0.08
244 0.05
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.03
252 0.04
253 0.05
254 0.05
255 0.05
256 0.05
257 0.06
258 0.07
259 0.07
260 0.06
261 0.06
262 0.06
263 0.05
264 0.05
265 0.04
266 0.03
267 0.03
268 0.03
269 0.03
270 0.03
271 0.03
272 0.02
273 0.03
274 0.03
275 0.04
276 0.07
277 0.1
278 0.1
279 0.12
280 0.12
281 0.13
282 0.14
283 0.14
284 0.13
285 0.12
286 0.12
287 0.11
288 0.12
289 0.11
290 0.11
291 0.11
292 0.1
293 0.1
294 0.12
295 0.13
296 0.15
297 0.15
298 0.16
299 0.16
300 0.18
301 0.17
302 0.15
303 0.16
304 0.14
305 0.16
306 0.19
307 0.19
308 0.2
309 0.21
310 0.21
311 0.2
312 0.22
313 0.21
314 0.15
315 0.14
316 0.12
317 0.12
318 0.15
319 0.15
320 0.14
321 0.15
322 0.16
323 0.16
324 0.15
325 0.18
326 0.18
327 0.17
328 0.17
329 0.23
330 0.25
331 0.26
332 0.28
333 0.27
334 0.28
335 0.35
336 0.41
337 0.39
338 0.45
339 0.53
340 0.59
341 0.6
342 0.57
343 0.51
344 0.45
345 0.45
346 0.42
347 0.35
348 0.27
349 0.24
350 0.23
351 0.22
352 0.22
353 0.18
354 0.14
355 0.1
356 0.09
357 0.1
358 0.11
359 0.1
360 0.09
361 0.1
362 0.11
363 0.12
364 0.11
365 0.13
366 0.12
367 0.14
368 0.15
369 0.15
370 0.16
371 0.18
372 0.18
373 0.17
374 0.19
375 0.19
376 0.19
377 0.2
378 0.23
379 0.22
380 0.22
381 0.26
382 0.28
383 0.27
384 0.26
385 0.23
386 0.21
387 0.22
388 0.22
389 0.19
390 0.15
391 0.15
392 0.14
393 0.14
394 0.11
395 0.09
396 0.08
397 0.07
398 0.05
399 0.04
400 0.04
401 0.04
402 0.04
403 0.04
404 0.03
405 0.03
406 0.03
407 0.04
408 0.04
409 0.05
410 0.06
411 0.06
412 0.06
413 0.07
414 0.07
415 0.07
416 0.07
417 0.06
418 0.06
419 0.05
420 0.05
421 0.05
422 0.05
423 0.05
424 0.05
425 0.04
426 0.04
427 0.05
428 0.05
429 0.05
430 0.07
431 0.09
432 0.11
433 0.15
434 0.2
435 0.24
436 0.35
437 0.42
438 0.47
439 0.54
440 0.61
441 0.68
442 0.72
443 0.76
444 0.72
445 0.69
446 0.65
447 0.6
448 0.54
449 0.43
450 0.38
451 0.38
452 0.32
453 0.28
454 0.27
455 0.23
456 0.23
457 0.25
458 0.26
459 0.2
460 0.22
461 0.26
462 0.28
463 0.27
464 0.27
465 0.28
466 0.28
467 0.25
468 0.22
469 0.18
470 0.15
471 0.16
472 0.16
473 0.13
474 0.11
475 0.14
476 0.14
477 0.14
478 0.13
479 0.14
480 0.18
481 0.18
482 0.21
483 0.18
484 0.19
485 0.23
486 0.24
487 0.22
488 0.18
489 0.17
490 0.16
491 0.19
492 0.18
493 0.14
494 0.15
495 0.15
496 0.13
497 0.17
498 0.14
499 0.11
500 0.12
501 0.13
502 0.12
503 0.13
504 0.14
505 0.1
506 0.1
507 0.09
508 0.08
509 0.07
510 0.07
511 0.06
512 0.05
513 0.05
514 0.12
515 0.16
516 0.2
517 0.22
518 0.25
519 0.33
520 0.35
521 0.41
522 0.39
523 0.46
524 0.49
525 0.55
526 0.59
527 0.56
528 0.63
529 0.57
530 0.52
531 0.47
532 0.44
533 0.39
534 0.32
535 0.29
536 0.24
537 0.24
538 0.24
539 0.2
540 0.17
541 0.14
542 0.13
543 0.12
544 0.08
545 0.06
546 0.05
547 0.05