Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NSB4

Protein Details
Accession A0A0E9NSB4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
567-589EEEWERRRKEWVKPPLRVKRGTLBasic
NLS Segment(s)
PositionSequence
574-575RK
579-580KP
Subcellular Location(s) cysk 12, cyto 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR042096  Dihydro-acid_dehy_C  
IPR004404  DihydroxyA_deHydtase  
IPR000581  DiOHA_6PGluconate_deHydtase  
IPR020558  DiOHA_6PGluconate_deHydtase_CS  
IPR037237  IlvD/EDD_N  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0004160  F:dihydroxy-acid dehydratase activity  
GO:0046872  F:metal ion binding  
GO:0009097  P:isoleucine biosynthetic process  
GO:0009099  P:valine biosynthetic process  
Pfam View protein in Pfam  
PF00920  ILVD_EDD  
PROSITE View protein in PROSITE  
PS00886  ILVD_EDD_1  
PS00887  ILVD_EDD_2  
Amino Acid Sequences MAHHLAKGDVARDVIRDDLIADTSLPARPSHFCQPGSLNKFSSTITQDLSQGGSQSMLYAIGLRDHEMDQPQIGIGSVWYSGNPCNSHLLELSENVKKAVKDARMVPMQFNTIGVSDAISMGTTGMRFSLQSREIIADSFETIMSAQWYDAMIAIPGCDKNMPAVLMAMARLNRPSIMLYGGAIQQGRRQVQPGASGIGKKDGRIDINDTWDAYGAFVNQTESAEGFRDVIRNACPGPGACGGQYTASTMATAAEAMGMSLPGSASNPAGSPEKLRECAKTAEAIKVLMEKDIKPLDIMTKPAFENAITMTMLLGGSTNSVLHLLAIASSANVDLSLDDFHRISAKTPLLADMKPSGNFYMTDLHELGGMPAIMKFLSSFGFLNGSIMTVTGRTLAENLKSAPSLPQDQVAIRPATNPIKETGHIRILYGNLAPGGAVAKITGKEGLEFRGKARCFDSERDLMDALDRKEIKREHGNTVIIVRYEGPKGGPGMPEMLKPGGAIQGLGLNDCIALVTDGRYSGASRGFIIGHVCPEAQDGGPIALVKDGDEVVIDSVGEMIDVLGVSEEEWERRRKEWVKPPLRVKRGTLLKYAKLVRDASHGCVTDLAEDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.13
5 0.13
6 0.13
7 0.12
8 0.11
9 0.11
10 0.13
11 0.15
12 0.15
13 0.14
14 0.16
15 0.19
16 0.25
17 0.34
18 0.39
19 0.37
20 0.4
21 0.47
22 0.55
23 0.58
24 0.56
25 0.49
26 0.43
27 0.44
28 0.41
29 0.39
30 0.33
31 0.29
32 0.27
33 0.26
34 0.26
35 0.25
36 0.27
37 0.21
38 0.18
39 0.15
40 0.14
41 0.12
42 0.11
43 0.1
44 0.08
45 0.07
46 0.08
47 0.08
48 0.11
49 0.11
50 0.12
51 0.14
52 0.15
53 0.19
54 0.19
55 0.2
56 0.17
57 0.17
58 0.16
59 0.14
60 0.13
61 0.09
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.09
68 0.11
69 0.16
70 0.17
71 0.18
72 0.23
73 0.23
74 0.25
75 0.24
76 0.26
77 0.22
78 0.24
79 0.27
80 0.25
81 0.25
82 0.24
83 0.26
84 0.23
85 0.25
86 0.3
87 0.29
88 0.3
89 0.34
90 0.4
91 0.44
92 0.45
93 0.44
94 0.39
95 0.37
96 0.32
97 0.28
98 0.22
99 0.15
100 0.15
101 0.12
102 0.1
103 0.08
104 0.08
105 0.07
106 0.06
107 0.05
108 0.05
109 0.06
110 0.05
111 0.05
112 0.05
113 0.06
114 0.06
115 0.08
116 0.15
117 0.16
118 0.17
119 0.18
120 0.2
121 0.2
122 0.2
123 0.19
124 0.12
125 0.12
126 0.11
127 0.1
128 0.08
129 0.07
130 0.07
131 0.08
132 0.07
133 0.06
134 0.06
135 0.07
136 0.07
137 0.07
138 0.07
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.08
146 0.08
147 0.09
148 0.1
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.09
155 0.1
156 0.09
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.11
163 0.1
164 0.1
165 0.09
166 0.09
167 0.1
168 0.11
169 0.12
170 0.11
171 0.11
172 0.12
173 0.17
174 0.19
175 0.18
176 0.19
177 0.2
178 0.22
179 0.25
180 0.23
181 0.21
182 0.2
183 0.21
184 0.19
185 0.24
186 0.23
187 0.19
188 0.22
189 0.22
190 0.23
191 0.24
192 0.29
193 0.23
194 0.28
195 0.28
196 0.25
197 0.22
198 0.21
199 0.18
200 0.13
201 0.11
202 0.07
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.07
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.09
216 0.09
217 0.11
218 0.11
219 0.12
220 0.12
221 0.12
222 0.12
223 0.1
224 0.14
225 0.14
226 0.14
227 0.12
228 0.12
229 0.12
230 0.12
231 0.12
232 0.09
233 0.08
234 0.07
235 0.07
236 0.06
237 0.06
238 0.05
239 0.05
240 0.04
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.03
248 0.03
249 0.03
250 0.03
251 0.04
252 0.04
253 0.05
254 0.05
255 0.07
256 0.09
257 0.09
258 0.1
259 0.14
260 0.17
261 0.2
262 0.21
263 0.21
264 0.22
265 0.24
266 0.23
267 0.24
268 0.23
269 0.22
270 0.21
271 0.2
272 0.17
273 0.17
274 0.16
275 0.13
276 0.13
277 0.11
278 0.14
279 0.15
280 0.14
281 0.12
282 0.12
283 0.14
284 0.14
285 0.16
286 0.13
287 0.14
288 0.14
289 0.15
290 0.14
291 0.11
292 0.1
293 0.08
294 0.09
295 0.07
296 0.07
297 0.06
298 0.06
299 0.06
300 0.05
301 0.05
302 0.03
303 0.03
304 0.03
305 0.03
306 0.03
307 0.04
308 0.04
309 0.03
310 0.04
311 0.03
312 0.03
313 0.04
314 0.03
315 0.03
316 0.03
317 0.03
318 0.03
319 0.03
320 0.03
321 0.02
322 0.03
323 0.04
324 0.05
325 0.06
326 0.06
327 0.06
328 0.09
329 0.09
330 0.1
331 0.14
332 0.14
333 0.14
334 0.14
335 0.18
336 0.18
337 0.18
338 0.19
339 0.17
340 0.18
341 0.18
342 0.19
343 0.16
344 0.14
345 0.14
346 0.14
347 0.16
348 0.14
349 0.16
350 0.15
351 0.15
352 0.14
353 0.14
354 0.13
355 0.08
356 0.07
357 0.05
358 0.05
359 0.05
360 0.04
361 0.04
362 0.04
363 0.04
364 0.05
365 0.07
366 0.07
367 0.07
368 0.09
369 0.08
370 0.09
371 0.08
372 0.08
373 0.06
374 0.06
375 0.06
376 0.05
377 0.05
378 0.06
379 0.06
380 0.06
381 0.07
382 0.09
383 0.1
384 0.11
385 0.12
386 0.12
387 0.12
388 0.12
389 0.14
390 0.15
391 0.18
392 0.17
393 0.17
394 0.18
395 0.18
396 0.2
397 0.21
398 0.19
399 0.15
400 0.16
401 0.19
402 0.23
403 0.24
404 0.23
405 0.21
406 0.23
407 0.24
408 0.26
409 0.26
410 0.27
411 0.26
412 0.25
413 0.24
414 0.22
415 0.23
416 0.2
417 0.15
418 0.09
419 0.09
420 0.08
421 0.06
422 0.06
423 0.05
424 0.04
425 0.04
426 0.06
427 0.06
428 0.08
429 0.09
430 0.08
431 0.1
432 0.12
433 0.15
434 0.19
435 0.19
436 0.2
437 0.27
438 0.27
439 0.28
440 0.29
441 0.31
442 0.31
443 0.34
444 0.39
445 0.36
446 0.37
447 0.37
448 0.35
449 0.29
450 0.29
451 0.29
452 0.24
453 0.26
454 0.26
455 0.24
456 0.31
457 0.32
458 0.35
459 0.4
460 0.43
461 0.43
462 0.48
463 0.49
464 0.43
465 0.44
466 0.4
467 0.3
468 0.26
469 0.21
470 0.17
471 0.16
472 0.16
473 0.13
474 0.13
475 0.16
476 0.18
477 0.17
478 0.16
479 0.2
480 0.2
481 0.2
482 0.21
483 0.19
484 0.16
485 0.15
486 0.15
487 0.13
488 0.12
489 0.11
490 0.09
491 0.12
492 0.12
493 0.12
494 0.11
495 0.08
496 0.08
497 0.08
498 0.07
499 0.04
500 0.05
501 0.05
502 0.06
503 0.07
504 0.07
505 0.08
506 0.09
507 0.1
508 0.12
509 0.15
510 0.14
511 0.15
512 0.16
513 0.16
514 0.16
515 0.18
516 0.16
517 0.15
518 0.16
519 0.15
520 0.13
521 0.14
522 0.15
523 0.12
524 0.12
525 0.11
526 0.1
527 0.11
528 0.11
529 0.1
530 0.09
531 0.09
532 0.09
533 0.09
534 0.09
535 0.08
536 0.08
537 0.08
538 0.08
539 0.08
540 0.07
541 0.06
542 0.06
543 0.06
544 0.05
545 0.04
546 0.03
547 0.04
548 0.04
549 0.04
550 0.04
551 0.04
552 0.04
553 0.07
554 0.08
555 0.12
556 0.16
557 0.22
558 0.25
559 0.27
560 0.37
561 0.41
562 0.51
563 0.58
564 0.65
565 0.69
566 0.76
567 0.85
568 0.86
569 0.88
570 0.83
571 0.77
572 0.76
573 0.75
574 0.7
575 0.69
576 0.66
577 0.62
578 0.65
579 0.66
580 0.6
581 0.55
582 0.53
583 0.45
584 0.47
585 0.45
586 0.43
587 0.44
588 0.4
589 0.35
590 0.35
591 0.34