Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9N8X0

Protein Details
Accession A0A0E9N8X0   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-40PSQTTNQPKKTNTKKRRHASVIRKPMIHydrophilic
NLS Segment(s)
PositionSequence
22-43KKTNTKKRRHASVIRKPMIKAR
Subcellular Location(s) nucl 14, mito_nucl 13.833, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MQGHAKQTRPGNRPSQTTNQPKKTNTKKRRHASVIRKPMIKARIRPITSFSCHCQHWSLISIPKLALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.63
3 0.63
4 0.69
5 0.72
6 0.71
7 0.72
8 0.71
9 0.75
10 0.77
11 0.79
12 0.78
13 0.79
14 0.8
15 0.82
16 0.87
17 0.85
18 0.84
19 0.84
20 0.84
21 0.83
22 0.77
23 0.71
24 0.62
25 0.6
26 0.58
27 0.52
28 0.47
29 0.45
30 0.5
31 0.5
32 0.51
33 0.5
34 0.48
35 0.47
36 0.45
37 0.4
38 0.35
39 0.34
40 0.36
41 0.34
42 0.29
43 0.27
44 0.27
45 0.28
46 0.3
47 0.31
48 0.31