Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NNC3

Protein Details
Accession A0A0E9NNC3   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-30LSDPAGRSGRPRPKKKVRCFIKTGKGTHydrophilic
NLS Segment(s)
PositionSequence
10-19RSGRPRPKKK
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MNELSDPAGRSGRPRPKKKVRCFIKTGKGTWTSSGTEWLFAFRYSPSQGHIQKRSNPTPIFPSTTTSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.64
3 0.73
4 0.83
5 0.89
6 0.9
7 0.88
8 0.86
9 0.85
10 0.83
11 0.82
12 0.76
13 0.67
14 0.63
15 0.57
16 0.5
17 0.44
18 0.37
19 0.29
20 0.24
21 0.26
22 0.2
23 0.17
24 0.16
25 0.15
26 0.13
27 0.12
28 0.12
29 0.08
30 0.11
31 0.12
32 0.13
33 0.14
34 0.22
35 0.29
36 0.37
37 0.45
38 0.48
39 0.54
40 0.62
41 0.66
42 0.66
43 0.6
44 0.56
45 0.55
46 0.53
47 0.51
48 0.43