FuNGI

Q5KLA8

Protein Details

Accession

Q5KLA8

Localization Confidence

High

Confidence Score

15.7

NoLS Segment(s)

Position	Sequence	Protein Nature
400-431	ARPLRKSATGRKVRRVKKTKREKDDKGYFVSK	Basic

NLS Segment(s)

Position	Sequence
255-260	KPPIKE
267-285	FARGPKEKMVKEQTKKEVK
393-422	RPKAKEEARPLRKSATGRKVRRVKKTKREK
460-466	RGGSKPP

Subcellular Location(s)

nucl 18, cyto_nucl 12.833, mito_nucl 10.833, cyto 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR019038 POLD3 IPR041913 POLD3_sf
Gene Ontology	GO:0043625 C:delta DNA polymerase complex GO:0006271 P:DNA strand elongation involved in DNA replication GO:1904161 P:DNA synthesis involved in UV-damage excision repair GO:0006297 P:nucleotide-excision repair, DNA gap filling
Pfam	View protein in Pfam PF09507 CDC27

Amino Acid Sequences

MITPEEQKQVTRKLTHWIESESKIVTYRTVSREIGCHVNVAKNILLRHFEANPSLAATYLLTGPLLSNSVLTQTTIQSGTTSKDGKSLRDLGDGMVKIVDMDQNSDAGDSDVEGLESQSQGQSKAQRIGLMGTDDEDERMDGVGNDRGAQVGDGGIGGGKRLGELGFKRERVKRWGVVLATAEALEEKKTLFDESELNIHIYALSPAPVKDPAQFLIASLELHDNANMYNSSIYGSITGHAFKPSAKPNPLAPAKPPIKEAAAPSIFARGPKEKMVKEQTKKEVKKQGSTKDVKDEPLQSRSSTSATTAPAKNKAQPLNKSNSKKRVINSDTEEDEPGPAKAKASTPTSKGGSSKTALEPTSSMVAREDKAALEAMAGMDVDFSDNEEPLAARPKAKEEARPLRKSATGRKVRRVKKTKREKDDKGYFVSKDYWTDESYSGESEPEQVETQPRAQPASKRGGSKPPMKARESASSVGSGSGAGAGGNMKKSAGKPTGGQSTLMGFFKKK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.56
2	0.58
3	0.55
4	0.53
5	0.51
6	0.49
7	0.5
8	0.42
9	0.36
10	0.32
11	0.29
12	0.25
13	0.23
14	0.28
15	0.3
16	0.34
17	0.35
18	0.34
19	0.37
20	0.39
21	0.4
22	0.33
23	0.33
24	0.3
25	0.33
26	0.32
27	0.32
28	0.3
29	0.27
30	0.28
31	0.28
32	0.29
33	0.26
34	0.29
35	0.28
36	0.28
37	0.27
38	0.26
39	0.23
40	0.21
41	0.19
42	0.15
43	0.13
44	0.11
45	0.1
46	0.09
47	0.09
48	0.07
49	0.07
50	0.07
51	0.08
52	0.09
53	0.08
54	0.08
55	0.07
56	0.1
57	0.1
58	0.11
59	0.11
60	0.11
61	0.14
62	0.14
63	0.14
64	0.12
65	0.13
66	0.15
67	0.19
68	0.2
69	0.18
70	0.25
71	0.26
72	0.28
73	0.33
74	0.37
75	0.34
76	0.35
77	0.35
78	0.3
79	0.34
80	0.32
81	0.26
82	0.19
83	0.17
84	0.13
85	0.13
86	0.14
87	0.08
88	0.11
89	0.1
90	0.11
91	0.11
92	0.11
93	0.11
94	0.09
95	0.08
96	0.06
97	0.07
98	0.06
99	0.06
100	0.06
101	0.06
102	0.07
103	0.07
104	0.07
105	0.08
106	0.09
107	0.1
108	0.14
109	0.19
110	0.23
111	0.28
112	0.29
113	0.28
114	0.28
115	0.29
116	0.27
117	0.23
118	0.18
119	0.14
120	0.14
121	0.12
122	0.12
123	0.1
124	0.08
125	0.07
126	0.07
127	0.07
128	0.06
129	0.08
130	0.1
131	0.1
132	0.11
133	0.1
134	0.1
135	0.1
136	0.1
137	0.08
138	0.05
139	0.05
140	0.04
141	0.04
142	0.04
143	0.04
144	0.04
145	0.04
146	0.04
147	0.04
148	0.05
149	0.05
150	0.09
151	0.11
152	0.18
153	0.23
154	0.26
155	0.32
156	0.37
157	0.41
158	0.44
159	0.49
160	0.46
161	0.44
162	0.47
163	0.41
164	0.38
165	0.35
166	0.28
167	0.22
168	0.18
169	0.14
170	0.09
171	0.09
172	0.07
173	0.06
174	0.05
175	0.05
176	0.06
177	0.07
178	0.07
179	0.08
180	0.1
181	0.11
182	0.13
183	0.14
184	0.13
185	0.13
186	0.12
187	0.11
188	0.09
189	0.08
190	0.06
191	0.06
192	0.07
193	0.07
194	0.08
195	0.1
196	0.11
197	0.12
198	0.13
199	0.13
200	0.14
201	0.14
202	0.13
203	0.12
204	0.12
205	0.1
206	0.09
207	0.09
208	0.07
209	0.08
210	0.07
211	0.06
212	0.06
213	0.07
214	0.06
215	0.06
216	0.05
217	0.05
218	0.06
219	0.06
220	0.06
221	0.06
222	0.06
223	0.06
224	0.07
225	0.08
226	0.07
227	0.08
228	0.08
229	0.08
230	0.12
231	0.18
232	0.23
233	0.25
234	0.26
235	0.27
236	0.35
237	0.38
238	0.34
239	0.3
240	0.33
241	0.34
242	0.34
243	0.33
244	0.26
245	0.25
246	0.25
247	0.25
248	0.23
249	0.2
250	0.2
251	0.19
252	0.2
253	0.19
254	0.18
255	0.2
256	0.15
257	0.16
258	0.21
259	0.27
260	0.24
261	0.31
262	0.4
263	0.46
264	0.49
265	0.55
266	0.59
267	0.64
268	0.66
269	0.67
270	0.67
271	0.61
272	0.64
273	0.63
274	0.62
275	0.61
276	0.63
277	0.57
278	0.56
279	0.55
280	0.48
281	0.45
282	0.43
283	0.37
284	0.37
285	0.36
286	0.28
287	0.28
288	0.27
289	0.25
290	0.19
291	0.17
292	0.15
293	0.16
294	0.21
295	0.23
296	0.24
297	0.29
298	0.31
299	0.33
300	0.37
301	0.42
302	0.44
303	0.48
304	0.51
305	0.54
306	0.61
307	0.66
308	0.67
309	0.69
310	0.68
311	0.66
312	0.63
313	0.64
314	0.59
315	0.57
316	0.55
317	0.5
318	0.46
319	0.43
320	0.41
321	0.3
322	0.28
323	0.21
324	0.16
325	0.13
326	0.11
327	0.1
328	0.11
329	0.14
330	0.17
331	0.23
332	0.26
333	0.27
334	0.32
335	0.34
336	0.34
337	0.33
338	0.31
339	0.29
340	0.27
341	0.28
342	0.25
343	0.27
344	0.25
345	0.24
346	0.22
347	0.2
348	0.23
349	0.19
350	0.17
351	0.15
352	0.17
353	0.16
354	0.17
355	0.16
356	0.12
357	0.13
358	0.13
359	0.1
360	0.08
361	0.08
362	0.06
363	0.06
364	0.05
365	0.04
366	0.04
367	0.04
368	0.04
369	0.04
370	0.06
371	0.06
372	0.06
373	0.06
374	0.07
375	0.07
376	0.08
377	0.16
378	0.15
379	0.18
380	0.19
381	0.24
382	0.31
383	0.34
384	0.4
385	0.42
386	0.53
387	0.6
388	0.64
389	0.61
390	0.58
391	0.6
392	0.59
393	0.59
394	0.59
395	0.6
396	0.62
397	0.7
398	0.76
399	0.79
400	0.84
401	0.85
402	0.85
403	0.85
404	0.9
405	0.9
406	0.91
407	0.93
408	0.91
409	0.91
410	0.9
411	0.84
412	0.8
413	0.75
414	0.65
415	0.57
416	0.52
417	0.43
418	0.37
419	0.35
420	0.3
421	0.26
422	0.28
423	0.26
424	0.25
425	0.24
426	0.22
427	0.19
428	0.17
429	0.16
430	0.15
431	0.15
432	0.14
433	0.14
434	0.14
435	0.19
436	0.21
437	0.25
438	0.26
439	0.27
440	0.29
441	0.33
442	0.38
443	0.4
444	0.47
445	0.48
446	0.5
447	0.53
448	0.59
449	0.63
450	0.65
451	0.69
452	0.69
453	0.72
454	0.69
455	0.69
456	0.64
457	0.66
458	0.62
459	0.54
460	0.45
461	0.39
462	0.36
463	0.32
464	0.26
465	0.17
466	0.11
467	0.09
468	0.07
469	0.05
470	0.06
471	0.08
472	0.1
473	0.12
474	0.12
475	0.12
476	0.16
477	0.18
478	0.26
479	0.29
480	0.29
481	0.32
482	0.39
483	0.47
484	0.45
485	0.44
486	0.37
487	0.36
488	0.38
489	0.36

Q5KLA8

3D AlphaFold-predicted Structure Viewer