Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KLA8

Protein Details
Accession Q5KLA8   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
400-431ARPLRKSATGRKVRRVKKTKREKDDKGYFVSKBasic
NLS Segment(s)
PositionSequence
255-260KPPIKE
267-285FARGPKEKMVKEQTKKEVK
393-422RPKAKEEARPLRKSATGRKVRRVKKTKREK
460-466RGGSKPP
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 10.833, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006271  P:DNA strand elongation involved in DNA replication  
GO:1904161  P:DNA synthesis involved in UV-damage excision repair  
GO:0006297  P:nucleotide-excision repair, DNA gap filling  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MITPEEQKQVTRKLTHWIESESKIVTYRTVSREIGCHVNVAKNILLRHFEANPSLAATYLLTGPLLSNSVLTQTTIQSGTTSKDGKSLRDLGDGMVKIVDMDQNSDAGDSDVEGLESQSQGQSKAQRIGLMGTDDEDERMDGVGNDRGAQVGDGGIGGGKRLGELGFKRERVKRWGVVLATAEALEEKKTLFDESELNIHIYALSPAPVKDPAQFLIASLELHDNANMYNSSIYGSITGHAFKPSAKPNPLAPAKPPIKEAAAPSIFARGPKEKMVKEQTKKEVKKQGSTKDVKDEPLQSRSSTSATTAPAKNKAQPLNKSNSKKRVINSDTEEDEPGPAKAKASTPTSKGGSSKTALEPTSSMVAREDKAALEAMAGMDVDFSDNEEPLAARPKAKEEARPLRKSATGRKVRRVKKTKREKDDKGYFVSKDYWTDESYSGESEPEQVETQPRAQPASKRGGSKPPMKARESASSVGSGSGAGAGGNMKKSAGKPTGGQSTLMGFFKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.55
4 0.53
5 0.51
6 0.49
7 0.5
8 0.42
9 0.36
10 0.32
11 0.29
12 0.25
13 0.23
14 0.28
15 0.3
16 0.34
17 0.35
18 0.34
19 0.37
20 0.39
21 0.4
22 0.33
23 0.33
24 0.3
25 0.33
26 0.32
27 0.32
28 0.3
29 0.27
30 0.28
31 0.28
32 0.29
33 0.26
34 0.29
35 0.28
36 0.28
37 0.27
38 0.26
39 0.23
40 0.21
41 0.19
42 0.15
43 0.13
44 0.11
45 0.1
46 0.09
47 0.09
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.08
54 0.08
55 0.07
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.14
62 0.14
63 0.14
64 0.12
65 0.13
66 0.15
67 0.19
68 0.2
69 0.18
70 0.25
71 0.26
72 0.28
73 0.33
74 0.37
75 0.34
76 0.35
77 0.35
78 0.3
79 0.34
80 0.32
81 0.26
82 0.19
83 0.17
84 0.13
85 0.13
86 0.14
87 0.08
88 0.11
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.09
95 0.08
96 0.06
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.1
108 0.14
109 0.19
110 0.23
111 0.28
112 0.29
113 0.28
114 0.28
115 0.29
116 0.27
117 0.23
118 0.18
119 0.14
120 0.14
121 0.12
122 0.12
123 0.1
124 0.08
125 0.07
126 0.07
127 0.07
128 0.06
129 0.08
130 0.1
131 0.1
132 0.11
133 0.1
134 0.1
135 0.1
136 0.1
137 0.08
138 0.05
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.09
151 0.11
152 0.18
153 0.23
154 0.26
155 0.32
156 0.37
157 0.41
158 0.44
159 0.49
160 0.46
161 0.44
162 0.47
163 0.41
164 0.38
165 0.35
166 0.28
167 0.22
168 0.18
169 0.14
170 0.09
171 0.09
172 0.07
173 0.06
174 0.05
175 0.05
176 0.06
177 0.07
178 0.07
179 0.08
180 0.1
181 0.11
182 0.13
183 0.14
184 0.13
185 0.13
186 0.12
187 0.11
188 0.09
189 0.08
190 0.06
191 0.06
192 0.07
193 0.07
194 0.08
195 0.1
196 0.11
197 0.12
198 0.13
199 0.13
200 0.14
201 0.14
202 0.13
203 0.12
204 0.12
205 0.1
206 0.09
207 0.09
208 0.07
209 0.08
210 0.07
211 0.06
212 0.06
213 0.07
214 0.06
215 0.06
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.06
224 0.07
225 0.08
226 0.07
227 0.08
228 0.08
229 0.08
230 0.12
231 0.18
232 0.23
233 0.25
234 0.26
235 0.27
236 0.35
237 0.38
238 0.34
239 0.3
240 0.33
241 0.34
242 0.34
243 0.33
244 0.26
245 0.25
246 0.25
247 0.25
248 0.23
249 0.2
250 0.2
251 0.19
252 0.2
253 0.19
254 0.18
255 0.2
256 0.15
257 0.16
258 0.21
259 0.27
260 0.24
261 0.31
262 0.4
263 0.46
264 0.49
265 0.55
266 0.59
267 0.64
268 0.66
269 0.67
270 0.67
271 0.61
272 0.64
273 0.63
274 0.62
275 0.61
276 0.63
277 0.57
278 0.56
279 0.55
280 0.48
281 0.45
282 0.43
283 0.37
284 0.37
285 0.36
286 0.28
287 0.28
288 0.27
289 0.25
290 0.19
291 0.17
292 0.15
293 0.16
294 0.21
295 0.23
296 0.24
297 0.29
298 0.31
299 0.33
300 0.37
301 0.42
302 0.44
303 0.48
304 0.51
305 0.54
306 0.61
307 0.66
308 0.67
309 0.69
310 0.68
311 0.66
312 0.63
313 0.64
314 0.59
315 0.57
316 0.55
317 0.5
318 0.46
319 0.43
320 0.41
321 0.3
322 0.28
323 0.21
324 0.16
325 0.13
326 0.11
327 0.1
328 0.11
329 0.14
330 0.17
331 0.23
332 0.26
333 0.27
334 0.32
335 0.34
336 0.34
337 0.33
338 0.31
339 0.29
340 0.27
341 0.28
342 0.25
343 0.27
344 0.25
345 0.24
346 0.22
347 0.2
348 0.23
349 0.19
350 0.17
351 0.15
352 0.17
353 0.16
354 0.17
355 0.16
356 0.12
357 0.13
358 0.13
359 0.1
360 0.08
361 0.08
362 0.06
363 0.06
364 0.05
365 0.04
366 0.04
367 0.04
368 0.04
369 0.04
370 0.06
371 0.06
372 0.06
373 0.06
374 0.07
375 0.07
376 0.08
377 0.16
378 0.15
379 0.18
380 0.19
381 0.24
382 0.31
383 0.34
384 0.4
385 0.42
386 0.53
387 0.6
388 0.64
389 0.61
390 0.58
391 0.6
392 0.59
393 0.59
394 0.59
395 0.6
396 0.62
397 0.7
398 0.76
399 0.79
400 0.84
401 0.85
402 0.85
403 0.85
404 0.9
405 0.9
406 0.91
407 0.93
408 0.91
409 0.91
410 0.9
411 0.84
412 0.8
413 0.75
414 0.65
415 0.57
416 0.52
417 0.43
418 0.37
419 0.35
420 0.3
421 0.26
422 0.28
423 0.26
424 0.25
425 0.24
426 0.22
427 0.19
428 0.17
429 0.16
430 0.15
431 0.15
432 0.14
433 0.14
434 0.14
435 0.19
436 0.21
437 0.25
438 0.26
439 0.27
440 0.29
441 0.33
442 0.38
443 0.4
444 0.47
445 0.48
446 0.5
447 0.53
448 0.59
449 0.63
450 0.65
451 0.69
452 0.69
453 0.72
454 0.69
455 0.69
456 0.64
457 0.66
458 0.62
459 0.54
460 0.45
461 0.39
462 0.36
463 0.32
464 0.26
465 0.17
466 0.11
467 0.09
468 0.07
469 0.05
470 0.06
471 0.08
472 0.1
473 0.12
474 0.12
475 0.12
476 0.16
477 0.18
478 0.26
479 0.29
480 0.29
481 0.32
482 0.39
483 0.47
484 0.45
485 0.44
486 0.37
487 0.36
488 0.38
489 0.36