FuNGI

A0A0E9NFW9

Protein Details

Accession

A0A0E9NFW9

Localization Confidence

Medium

Confidence Score

10.4

NoLS Segment(s)

Position	Sequence	Protein Nature
558-582	AEVGKDQDGKKKKEKKDKKDRYKPY	Basic

NLS Segment(s)

Position	Sequence
566-580	GKKKKEKKDKKDRYK

Subcellular Location(s)

mito 14, nucl 7.5, cyto_nucl 6, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018796 COA8 IPR015943 WD40/YVTN_repeat-like_dom_sf IPR001680 WD40_repeat IPR019775 WD40_repeat_CS IPR036322 WD40_repeat_dom_sf IPR039328 WDR89
Gene Ontology	GO:0005743 C:mitochondrial inner membrane GO:0097193 P:intrinsic apoptotic signaling pathway
Pfam	View protein in Pfam PF10231 COA8 PF00400 WD40
PROSITE	View protein in PROSITE PS00678 WD_REPEATS_1 PS50082 WD_REPEATS_2 PS50294 WD_REPEATS_REGION

Amino Acid Sequences

MLPRRIPQPTTGLCPISNPLLSSKSLSPSIRVRHVSFRRSRQQDHTSLSSSSSPTTYIALPDPTSNIRPLLYPYDPTSPRSLSLHRRRLAAHDRIHTHWSQNNIRYTLALEAFKKETFEKNKTEDGETREVGDDDMSAFYRRYLDETREEQMRFNRWWWRENVGLLVAGVNHKLLRAHSVKEANFGNGRSTALIQKAQTPLNAQTNIYASNMSGTLSPLQSTPFNPASLTYVLSLTPFPTHSLLIASGSDNSLRTFSLPILSPLSSIPQAHADSISAVCAYDEHHLVTAGKDRVVRMWDVRSTPPKCVMEYRAEGARKPQGFTSLAVQKRTGRIAAGTELVGVDAPVYIWDANEGGKPVRAYTESHNDDVTVLAFYPNQDHLLLSGSCDGLVSIFDLNVEDEDDAVLQVVNHNASIHRAGFLASGDAFFALSHMETFTIFPLRLETAERDVDDVSAEVKPIEFGDLRQVLGCDYVQNFDPVRGRVVVGSHEEGWVDIVSFDSATGKFGERWRMGGHDGEVARDLIIDEANAVVVSGGEDGTIKSWKAGGEISAQPTTAEVGKDQDGKKKKEKKDKKDRYKPY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.41
2	0.4
3	0.35
4	0.32
5	0.26
6	0.24
7	0.24
8	0.25
9	0.27
10	0.28
11	0.27
12	0.33
13	0.33
14	0.34
15	0.39
16	0.45
17	0.49
18	0.52
19	0.51
20	0.55
21	0.63
22	0.68
23	0.69
24	0.72
25	0.74
26	0.77
27	0.8
28	0.79
29	0.79
30	0.77
31	0.75
32	0.7
33	0.63
34	0.56
35	0.52
36	0.45
37	0.37
38	0.31
39	0.25
40	0.2
41	0.17
42	0.19
43	0.17
44	0.16
45	0.17
46	0.19
47	0.19
48	0.19
49	0.22
50	0.24
51	0.25
52	0.24
53	0.23
54	0.2
55	0.21
56	0.23
57	0.27
58	0.25
59	0.26
60	0.28
61	0.36
62	0.37
63	0.39
64	0.4
65	0.35
66	0.35
67	0.36
68	0.4
69	0.42
70	0.51
71	0.58
72	0.56
73	0.58
74	0.57
75	0.62
76	0.64
77	0.62
78	0.58
79	0.56
80	0.58
81	0.58
82	0.61
83	0.54
84	0.49
85	0.43
86	0.44
87	0.45
88	0.47
89	0.5
90	0.46
91	0.45
92	0.4
93	0.38
94	0.34
95	0.29
96	0.26
97	0.21
98	0.23
99	0.25
100	0.25
101	0.26
102	0.24
103	0.29
104	0.34
105	0.39
106	0.42
107	0.44
108	0.49
109	0.5
110	0.53
111	0.49
112	0.47
113	0.47
114	0.41
115	0.38
116	0.34
117	0.31
118	0.26
119	0.21
120	0.15
121	0.1
122	0.1
123	0.09
124	0.09
125	0.09
126	0.09
127	0.11
128	0.11
129	0.15
130	0.18
131	0.21
132	0.27
133	0.3
134	0.33
135	0.37
136	0.37
137	0.36
138	0.38
139	0.39
140	0.34
141	0.35
142	0.41
143	0.38
144	0.43
145	0.42
146	0.41
147	0.39
148	0.38
149	0.35
150	0.27
151	0.24
152	0.19
153	0.16
154	0.12
155	0.1
156	0.09
157	0.07
158	0.06
159	0.07
160	0.08
161	0.08
162	0.14
163	0.16
164	0.18
165	0.24
166	0.3
167	0.3
168	0.34
169	0.34
170	0.3
171	0.3
172	0.28
173	0.24
174	0.19
175	0.19
176	0.15
177	0.16
178	0.15
179	0.16
180	0.18
181	0.16
182	0.2
183	0.22
184	0.23
185	0.22
186	0.22
187	0.24
188	0.27
189	0.28
190	0.24
191	0.22
192	0.22
193	0.22
194	0.2
195	0.16
196	0.09
197	0.09
198	0.09
199	0.08
200	0.07
201	0.07
202	0.08
203	0.08
204	0.09
205	0.08
206	0.1
207	0.11
208	0.11
209	0.16
210	0.16
211	0.16
212	0.15
213	0.16
214	0.17
215	0.17
216	0.17
217	0.12
218	0.11
219	0.1
220	0.11
221	0.11
222	0.08
223	0.08
224	0.08
225	0.09
226	0.09
227	0.09
228	0.09
229	0.1
230	0.09
231	0.09
232	0.09
233	0.08
234	0.07
235	0.07
236	0.08
237	0.07
238	0.07
239	0.07
240	0.07
241	0.07
242	0.07
243	0.07
244	0.09
245	0.09
246	0.1
247	0.12
248	0.12
249	0.11
250	0.11
251	0.12
252	0.11
253	0.11
254	0.1
255	0.11
256	0.12
257	0.12
258	0.12
259	0.1
260	0.09
261	0.09
262	0.09
263	0.05
264	0.05
265	0.04
266	0.04
267	0.05
268	0.06
269	0.07
270	0.07
271	0.07
272	0.07
273	0.08
274	0.08
275	0.13
276	0.12
277	0.13
278	0.14
279	0.14
280	0.15
281	0.16
282	0.17
283	0.13
284	0.15
285	0.16
286	0.18
287	0.22
288	0.29
289	0.29
290	0.29
291	0.34
292	0.32
293	0.31
294	0.32
295	0.31
296	0.28
297	0.28
298	0.29
299	0.27
300	0.27
301	0.26
302	0.26
303	0.3
304	0.25
305	0.24
306	0.23
307	0.21
308	0.22
309	0.22
310	0.24
311	0.25
312	0.27
313	0.27
314	0.28
315	0.27
316	0.28
317	0.28
318	0.23
319	0.16
320	0.14
321	0.14
322	0.14
323	0.13
324	0.1
325	0.09
326	0.08
327	0.08
328	0.07
329	0.05
330	0.04
331	0.03
332	0.03
333	0.03
334	0.04
335	0.04
336	0.04
337	0.04
338	0.04
339	0.05
340	0.06
341	0.07
342	0.07
343	0.09
344	0.09
345	0.09
346	0.1
347	0.11
348	0.13
349	0.17
350	0.26
351	0.27
352	0.28
353	0.28
354	0.26
355	0.25
356	0.23
357	0.19
358	0.09
359	0.06
360	0.06
361	0.06
362	0.06
363	0.08
364	0.09
365	0.09
366	0.09
367	0.09
368	0.09
369	0.12
370	0.12
371	0.11
372	0.11
373	0.1
374	0.1
375	0.09
376	0.09
377	0.05
378	0.05
379	0.05
380	0.04
381	0.04
382	0.04
383	0.05
384	0.05
385	0.05
386	0.06
387	0.05
388	0.05
389	0.05
390	0.05
391	0.05
392	0.04
393	0.04
394	0.03
395	0.05
396	0.06
397	0.06
398	0.06
399	0.07
400	0.07
401	0.09
402	0.11
403	0.11
404	0.1
405	0.1
406	0.1
407	0.11
408	0.11
409	0.1
410	0.08
411	0.08
412	0.07
413	0.07
414	0.06
415	0.05
416	0.05
417	0.04
418	0.04
419	0.05
420	0.05
421	0.05
422	0.06
423	0.06
424	0.08
425	0.1
426	0.1
427	0.09
428	0.11
429	0.12
430	0.12
431	0.14
432	0.15
433	0.17
434	0.19
435	0.2
436	0.19
437	0.18
438	0.17
439	0.15
440	0.13
441	0.1
442	0.08
443	0.08
444	0.07
445	0.07
446	0.07
447	0.07
448	0.1
449	0.09
450	0.09
451	0.17
452	0.18
453	0.19
454	0.19
455	0.19
456	0.16
457	0.17
458	0.17
459	0.11
460	0.11
461	0.12
462	0.12
463	0.15
464	0.16
465	0.18
466	0.22
467	0.2
468	0.22
469	0.21
470	0.21
471	0.19
472	0.2
473	0.2
474	0.2
475	0.22
476	0.2
477	0.2
478	0.19
479	0.18
480	0.17
481	0.14
482	0.1
483	0.07
484	0.07
485	0.07
486	0.07
487	0.07
488	0.08
489	0.08
490	0.09
491	0.11
492	0.12
493	0.15
494	0.2
495	0.29
496	0.27
497	0.3
498	0.31
499	0.33
500	0.33
501	0.32
502	0.3
503	0.27
504	0.26
505	0.25
506	0.24
507	0.21
508	0.19
509	0.16
510	0.14
511	0.09
512	0.09
513	0.07
514	0.06
515	0.06
516	0.06
517	0.06
518	0.05
519	0.04
520	0.04
521	0.04
522	0.05
523	0.04
524	0.04
525	0.05
526	0.05
527	0.08
528	0.1
529	0.1
530	0.1
531	0.12
532	0.13
533	0.14
534	0.15
535	0.15
536	0.19
537	0.23
538	0.28
539	0.27
540	0.26
541	0.24
542	0.24
543	0.24
544	0.2
545	0.16
546	0.12
547	0.15
548	0.2
549	0.28
550	0.3
551	0.38
552	0.45
553	0.52
554	0.61
555	0.68
556	0.74
557	0.78
558	0.86
559	0.88
560	0.9
561	0.94
562	0.95

A0A0E9NFW9

3D AlphaFold-predicted Structure Viewer