Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NEB5

Protein Details
Accession A0A0E9NEB5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-54QAKKRWLVIKPRRRRARFCLHydrophilic
NLS Segment(s)
PositionSequence
37-50KKRWLVIKPRRRRA
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MSAAACAENPSEHNSSSQPNRGARTRVPSKFLVSQAKKRWLVIKPRRRRARFCLITLRGITLKSLLRFLISSSSDQNVRYPRSSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.27
3 0.31
4 0.36
5 0.37
6 0.38
7 0.42
8 0.44
9 0.47
10 0.44
11 0.48
12 0.51
13 0.48
14 0.49
15 0.46
16 0.46
17 0.45
18 0.47
19 0.48
20 0.44
21 0.49
22 0.52
23 0.58
24 0.55
25 0.51
26 0.52
27 0.48
28 0.54
29 0.56
30 0.59
31 0.61
32 0.71
33 0.8
34 0.79
35 0.8
36 0.77
37 0.78
38 0.73
39 0.67
40 0.67
41 0.59
42 0.58
43 0.51
44 0.46
45 0.36
46 0.3
47 0.26
48 0.18
49 0.19
50 0.16
51 0.17
52 0.15
53 0.15
54 0.15
55 0.16
56 0.19
57 0.17
58 0.18
59 0.2
60 0.23
61 0.23
62 0.24
63 0.29
64 0.3
65 0.33
66 0.33