Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NS01

Protein Details
Accession A0A0E9NS01   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRKNSKKKHPYPKSQRRSVGLFHydrophilic
NLS Segment(s)
PositionSequence
6-8KKK
Subcellular Location(s) plas 13, mito 7, E.R. 2, golg 2, cyto 1, extr 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRKNSKKKHPYPKSQRRSVGLFCVALLGPIVVVAFFWLFVLWFFVFVVMERLFFVYVLPMMGPLLLFRNSLLHCLIIHSALRPSFSVSSVLRLLPFAKGSRAGAANTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.89
3 0.83
4 0.79
5 0.71
6 0.67
7 0.59
8 0.49
9 0.39
10 0.34
11 0.28
12 0.21
13 0.17
14 0.09
15 0.05
16 0.05
17 0.05
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.1
35 0.07
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.07
42 0.04
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.05
52 0.06
53 0.06
54 0.06
55 0.1
56 0.11
57 0.13
58 0.13
59 0.11
60 0.11
61 0.12
62 0.13
63 0.11
64 0.11
65 0.1
66 0.13
67 0.13
68 0.14
69 0.13
70 0.16
71 0.15
72 0.16
73 0.19
74 0.17
75 0.2
76 0.21
77 0.21
78 0.18
79 0.18
80 0.18
81 0.16
82 0.19
83 0.16
84 0.18
85 0.2
86 0.21
87 0.25
88 0.26