Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NDQ0

Protein Details
Accession A0A0E9NDQ0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
218-238LTEEDKKKKVQERLEERTRKEBasic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR040466  NKAP  
IPR009269  NKAP_C  
Gene Ontology GO:0003682  F:chromatin binding  
Pfam View protein in Pfam  
PF06047  Nkap_C  
Amino Acid Sequences MYDDESLNDTKPYGQDGQWRSIRKNDSARVLRTRRAVNVEKVLRTNRDIGRGRISIHPGGIVRRRVIGHPDATVRGPGIDRNATTEIGIGRPRDTDHDEIATVHLHTIDQRSSSRSRVPKPSRDERVNEDNEGDAWVEKSAESRPKPITSKPQPTEADDPSDDEIGPLPPSGGLPTNSPADPPAPTHLSKLEAAGYVLSGSRHKRMAALRAKATSKILTEEDKKKKVQERLEERTRKEEVILEGFRSMVRERQQGENKEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.3
3 0.34
4 0.42
5 0.46
6 0.49
7 0.47
8 0.52
9 0.54
10 0.53
11 0.58
12 0.56
13 0.6
14 0.63
15 0.67
16 0.69
17 0.69
18 0.66
19 0.64
20 0.62
21 0.57
22 0.58
23 0.57
24 0.54
25 0.58
26 0.58
27 0.55
28 0.56
29 0.55
30 0.5
31 0.47
32 0.48
33 0.41
34 0.45
35 0.45
36 0.44
37 0.46
38 0.44
39 0.44
40 0.41
41 0.43
42 0.35
43 0.31
44 0.3
45 0.24
46 0.29
47 0.32
48 0.31
49 0.27
50 0.29
51 0.3
52 0.29
53 0.33
54 0.32
55 0.28
56 0.27
57 0.29
58 0.27
59 0.26
60 0.25
61 0.19
62 0.16
63 0.14
64 0.13
65 0.14
66 0.15
67 0.14
68 0.18
69 0.19
70 0.19
71 0.18
72 0.18
73 0.15
74 0.15
75 0.17
76 0.13
77 0.12
78 0.13
79 0.13
80 0.16
81 0.2
82 0.2
83 0.19
84 0.2
85 0.2
86 0.19
87 0.19
88 0.16
89 0.11
90 0.09
91 0.07
92 0.06
93 0.07
94 0.09
95 0.08
96 0.1
97 0.11
98 0.14
99 0.16
100 0.19
101 0.25
102 0.3
103 0.34
104 0.43
105 0.49
106 0.54
107 0.6
108 0.66
109 0.67
110 0.66
111 0.63
112 0.59
113 0.6
114 0.54
115 0.47
116 0.38
117 0.3
118 0.25
119 0.22
120 0.16
121 0.08
122 0.06
123 0.05
124 0.05
125 0.05
126 0.06
127 0.09
128 0.16
129 0.16
130 0.2
131 0.23
132 0.28
133 0.31
134 0.34
135 0.41
136 0.43
137 0.53
138 0.5
139 0.56
140 0.53
141 0.55
142 0.56
143 0.47
144 0.42
145 0.32
146 0.32
147 0.25
148 0.24
149 0.19
150 0.13
151 0.13
152 0.09
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.07
159 0.08
160 0.08
161 0.1
162 0.12
163 0.15
164 0.14
165 0.14
166 0.14
167 0.14
168 0.14
169 0.14
170 0.16
171 0.18
172 0.19
173 0.2
174 0.21
175 0.23
176 0.22
177 0.21
178 0.18
179 0.14
180 0.14
181 0.12
182 0.1
183 0.08
184 0.08
185 0.08
186 0.11
187 0.13
188 0.16
189 0.18
190 0.18
191 0.23
192 0.27
193 0.36
194 0.41
195 0.45
196 0.46
197 0.5
198 0.52
199 0.49
200 0.47
201 0.4
202 0.32
203 0.29
204 0.27
205 0.29
206 0.35
207 0.43
208 0.5
209 0.53
210 0.54
211 0.59
212 0.64
213 0.66
214 0.68
215 0.68
216 0.69
217 0.73
218 0.81
219 0.82
220 0.77
221 0.75
222 0.69
223 0.59
224 0.51
225 0.46
226 0.4
227 0.4
228 0.38
229 0.32
230 0.3
231 0.29
232 0.28
233 0.25
234 0.22
235 0.2
236 0.24
237 0.3
238 0.33
239 0.43
240 0.52
241 0.56
242 0.61