Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NKM2

Protein Details
Accession A0A0E9NKM2   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
33-58REGHEEQKRNPRQFKRKKVSDPLLFAHydrophilic
NLS Segment(s)
PositionSequence
40-50KRNPRQFKRKK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MSNTPKQQNEKPITKAKDKESKVHVYGTSHRTREGHEEQKRNPRQFKRKKVSDPLLFAPPLNKAHQNNPRRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.68
3 0.66
4 0.67
5 0.63
6 0.64
7 0.61
8 0.62
9 0.55
10 0.53
11 0.46
12 0.4
13 0.44
14 0.43
15 0.42
16 0.36
17 0.36
18 0.32
19 0.32
20 0.36
21 0.37
22 0.4
23 0.41
24 0.47
25 0.5
26 0.61
27 0.67
28 0.66
29 0.68
30 0.68
31 0.72
32 0.77
33 0.82
34 0.82
35 0.84
36 0.86
37 0.87
38 0.87
39 0.83
40 0.78
41 0.71
42 0.66
43 0.57
44 0.48
45 0.39
46 0.34
47 0.3
48 0.28
49 0.32
50 0.3
51 0.4
52 0.49