Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NCZ0

Protein Details
Accession A0A0E9NCZ0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
170-201EYEAANPRRRWRPSKKRREFEKRKKAEAEEKABasic
NLS Segment(s)
PositionSequence
176-216PRRRWRPSKKRREFEKRKKAEAEEKARRKTAKAGRGGVRGG
Subcellular Location(s) cyto 9.5cyto_nucl 9.5, nucl 8.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MSFGGQRTTRAELFASDDADHTDHAQENDAETRAAILAALSASLTLPPVASDSVPITTPPANEEEGGEEVFEFNLFGGGGGMKIKVADDAPVEEKWVRRERPMSYYVVDPSDEVRRAQIEAAAISGTQILQLSTHSLEPLLTKPRKLLRISAHTRRPIPAHLPPTITAAEYEAANPRRRWRPSKKRREFEKRKKAEAEEKARRKTAKAGRGGVRGGQVGSAAGGRKWATE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.2
4 0.2
5 0.2
6 0.2
7 0.19
8 0.15
9 0.15
10 0.15
11 0.16
12 0.18
13 0.16
14 0.18
15 0.2
16 0.2
17 0.17
18 0.14
19 0.14
20 0.12
21 0.11
22 0.08
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.04
30 0.04
31 0.05
32 0.04
33 0.04
34 0.04
35 0.06
36 0.07
37 0.07
38 0.08
39 0.09
40 0.1
41 0.1
42 0.1
43 0.12
44 0.12
45 0.13
46 0.13
47 0.14
48 0.14
49 0.14
50 0.14
51 0.14
52 0.13
53 0.13
54 0.11
55 0.09
56 0.08
57 0.08
58 0.07
59 0.05
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.04
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.08
77 0.11
78 0.11
79 0.12
80 0.13
81 0.14
82 0.19
83 0.26
84 0.25
85 0.27
86 0.31
87 0.32
88 0.36
89 0.38
90 0.34
91 0.28
92 0.29
93 0.26
94 0.23
95 0.2
96 0.15
97 0.13
98 0.15
99 0.14
100 0.12
101 0.12
102 0.11
103 0.12
104 0.12
105 0.11
106 0.08
107 0.07
108 0.07
109 0.06
110 0.05
111 0.05
112 0.05
113 0.04
114 0.04
115 0.04
116 0.03
117 0.03
118 0.04
119 0.05
120 0.06
121 0.06
122 0.06
123 0.06
124 0.07
125 0.08
126 0.11
127 0.19
128 0.19
129 0.19
130 0.24
131 0.3
132 0.36
133 0.36
134 0.4
135 0.38
136 0.47
137 0.55
138 0.59
139 0.61
140 0.6
141 0.61
142 0.57
143 0.51
144 0.45
145 0.43
146 0.41
147 0.39
148 0.36
149 0.36
150 0.34
151 0.35
152 0.31
153 0.26
154 0.18
155 0.15
156 0.13
157 0.11
158 0.11
159 0.16
160 0.2
161 0.25
162 0.27
163 0.33
164 0.41
165 0.49
166 0.58
167 0.62
168 0.69
169 0.75
170 0.85
171 0.88
172 0.9
173 0.94
174 0.95
175 0.95
176 0.95
177 0.95
178 0.92
179 0.89
180 0.86
181 0.82
182 0.8
183 0.79
184 0.79
185 0.78
186 0.79
187 0.77
188 0.77
189 0.72
190 0.64
191 0.64
192 0.63
193 0.61
194 0.6
195 0.62
196 0.63
197 0.66
198 0.65
199 0.57
200 0.51
201 0.43
202 0.35
203 0.27
204 0.2
205 0.15
206 0.14
207 0.13
208 0.11
209 0.1
210 0.13