Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9N814

Protein Details
Accession A0A0E9N814    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-72HTKSTEATRRTQKRRQKTRKNDVKKGSEGFHydrophilic
NLS Segment(s)
PositionSequence
52-64RTQKRRQKTRKND
Subcellular Location(s) mito 12, nucl 11, cyto_nucl 10.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MDPRKSPPQPTRHVHHTTHTPSTILTGLCDPGDTDQTFIIASHTKSTEATRRTQKRRQKTRKNDVKKGSEGFNVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.62
3 0.62
4 0.59
5 0.57
6 0.5
7 0.41
8 0.34
9 0.34
10 0.3
11 0.21
12 0.16
13 0.11
14 0.11
15 0.11
16 0.11
17 0.09
18 0.07
19 0.11
20 0.1
21 0.1
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.1
31 0.11
32 0.12
33 0.15
34 0.2
35 0.21
36 0.28
37 0.36
38 0.46
39 0.54
40 0.62
41 0.69
42 0.74
43 0.83
44 0.87
45 0.88
46 0.89
47 0.92
48 0.94
49 0.95
50 0.94
51 0.92
52 0.89
53 0.85
54 0.78
55 0.71
56 0.65