Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q5KPQ8

Protein Details
Accession Q5KPQ8    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-50SLSANPNKKVPRNKPHVKPPFVDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, plas 9, cyto_nucl 7, cyto 2.5, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG cne:CNA01880  -  
Amino Acid Sequences MSAPEATGTRQRTNKVETPTNENQNPASLSANPNKKVPRNKPHVKPPFVDMSMNKFLTYLVLSLFLLFAFYMWRFTVWAHQAGGYWALITGHHMSPAEVAAKQAASSASASSSVASSTASATTSGHPQKIKAKPTQDAGDGDDNIQSQIFNLASALGITPAELSSAIRPLVDPSVPNPAEKAKQDAQLLQAKMASQQHENENQEGSVLDMLGEALLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.59
4 0.55
5 0.59
6 0.63
7 0.67
8 0.61
9 0.56
10 0.49
11 0.43
12 0.41
13 0.33
14 0.27
15 0.21
16 0.25
17 0.31
18 0.38
19 0.37
20 0.41
21 0.47
22 0.52
23 0.6
24 0.65
25 0.67
26 0.7
27 0.78
28 0.82
29 0.86
30 0.88
31 0.83
32 0.74
33 0.68
34 0.66
35 0.58
36 0.53
37 0.43
38 0.41
39 0.42
40 0.4
41 0.35
42 0.27
43 0.24
44 0.22
45 0.21
46 0.13
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.06
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.14
64 0.15
65 0.17
66 0.16
67 0.16
68 0.16
69 0.16
70 0.17
71 0.1
72 0.08
73 0.06
74 0.05
75 0.05
76 0.07
77 0.09
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.1
84 0.09
85 0.07
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.05
96 0.06
97 0.06
98 0.05
99 0.06
100 0.05
101 0.04
102 0.04
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.14
111 0.15
112 0.18
113 0.18
114 0.2
115 0.29
116 0.34
117 0.39
118 0.39
119 0.42
120 0.42
121 0.47
122 0.47
123 0.41
124 0.36
125 0.33
126 0.31
127 0.26
128 0.23
129 0.19
130 0.17
131 0.14
132 0.13
133 0.09
134 0.06
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.06
152 0.09
153 0.09
154 0.08
155 0.09
156 0.1
157 0.13
158 0.13
159 0.13
160 0.13
161 0.23
162 0.23
163 0.23
164 0.23
165 0.25
166 0.29
167 0.3
168 0.35
169 0.3
170 0.35
171 0.37
172 0.37
173 0.39
174 0.42
175 0.41
176 0.35
177 0.31
178 0.26
179 0.29
180 0.3
181 0.27
182 0.23
183 0.27
184 0.32
185 0.39
186 0.42
187 0.39
188 0.36
189 0.33
190 0.3
191 0.26
192 0.21
193 0.13
194 0.1
195 0.08
196 0.06
197 0.07