Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NPX6

Protein Details
Accession A0A0E9NPX6   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
31-50SVQRSKPKKVWLQCNRAGQYHydrophilic
212-233LCTCRCTQERRHIPPHHIRTTKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, cyto_nucl 9.5, cyto 7, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010061  MeMal-semiAld_DH  
Gene Ontology GO:0004491  F:methylmalonate-semialdehyde dehydrogenase (acylating) activity  
Amino Acid Sequences MDPPPDASFPTRKELELYAQAWAKPRGYAISVQRSKPKKVWLQCNRAGQYRNRLNLDSSSRQRKTSSKASGCPFRLVGKLSGPTGDWELSTMVDEHNHDPSDRPSAHPQHRKLTTGQIQQVERMTNAGAPPRTIVMTLRDDPDGNPDFLHREVYNAKRDIKTAKLAGRTPIVISPIWPAAARYPGAGVWYEETGVWHDQDPNGIQGHQPNGLCTCRCTQERRHIPPHHIRTTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.37
4 0.35
5 0.33
6 0.34
7 0.35
8 0.37
9 0.37
10 0.32
11 0.25
12 0.26
13 0.23
14 0.23
15 0.28
16 0.31
17 0.39
18 0.43
19 0.46
20 0.54
21 0.57
22 0.6
23 0.59
24 0.6
25 0.59
26 0.62
27 0.7
28 0.71
29 0.75
30 0.77
31 0.81
32 0.76
33 0.73
34 0.68
35 0.63
36 0.63
37 0.62
38 0.61
39 0.54
40 0.52
41 0.48
42 0.49
43 0.5
44 0.48
45 0.48
46 0.52
47 0.5
48 0.51
49 0.52
50 0.52
51 0.51
52 0.52
53 0.55
54 0.51
55 0.55
56 0.6
57 0.65
58 0.62
59 0.57
60 0.49
61 0.41
62 0.37
63 0.32
64 0.28
65 0.22
66 0.22
67 0.2
68 0.19
69 0.17
70 0.16
71 0.15
72 0.14
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.08
79 0.06
80 0.07
81 0.09
82 0.1
83 0.12
84 0.12
85 0.12
86 0.13
87 0.14
88 0.19
89 0.18
90 0.2
91 0.25
92 0.33
93 0.42
94 0.49
95 0.51
96 0.53
97 0.54
98 0.53
99 0.47
100 0.48
101 0.46
102 0.43
103 0.43
104 0.39
105 0.37
106 0.36
107 0.36
108 0.28
109 0.21
110 0.16
111 0.12
112 0.09
113 0.09
114 0.12
115 0.11
116 0.1
117 0.11
118 0.11
119 0.11
120 0.1
121 0.1
122 0.11
123 0.15
124 0.16
125 0.17
126 0.18
127 0.18
128 0.17
129 0.23
130 0.21
131 0.17
132 0.15
133 0.14
134 0.16
135 0.16
136 0.19
137 0.13
138 0.14
139 0.19
140 0.24
141 0.3
142 0.31
143 0.35
144 0.33
145 0.35
146 0.35
147 0.33
148 0.34
149 0.33
150 0.34
151 0.35
152 0.36
153 0.37
154 0.36
155 0.33
156 0.29
157 0.25
158 0.22
159 0.17
160 0.16
161 0.16
162 0.14
163 0.14
164 0.13
165 0.12
166 0.12
167 0.16
168 0.15
169 0.13
170 0.13
171 0.12
172 0.13
173 0.13
174 0.12
175 0.11
176 0.11
177 0.11
178 0.1
179 0.11
180 0.13
181 0.13
182 0.13
183 0.13
184 0.14
185 0.14
186 0.17
187 0.18
188 0.17
189 0.18
190 0.17
191 0.17
192 0.2
193 0.22
194 0.24
195 0.23
196 0.22
197 0.25
198 0.29
199 0.28
200 0.27
201 0.29
202 0.31
203 0.36
204 0.4
205 0.45
206 0.52
207 0.62
208 0.69
209 0.74
210 0.74
211 0.8
212 0.85
213 0.85