Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KAP4

Protein Details
Accession Q5KAP4    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-147FNMQAEKKKLKNLNRQNIKAANHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG cne:CNJ00980  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MNFTSYTVSDRLFAYIPRKHRMIALRPLTNLTSRRSIQVARIGAVSFSSSSSCASPKTKSGRAVVSSCPAGTPLTNLSVLKDKPDPVALPDDQYPAWLWTLLEDNSKAHKAEENAVHLTQEGESGFNMQAEKKKLKNLNRQNIKAANYLKSTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.28
3 0.34
4 0.38
5 0.39
6 0.37
7 0.42
8 0.47
9 0.48
10 0.52
11 0.54
12 0.53
13 0.52
14 0.54
15 0.5
16 0.46
17 0.41
18 0.35
19 0.33
20 0.3
21 0.31
22 0.32
23 0.31
24 0.3
25 0.35
26 0.32
27 0.26
28 0.26
29 0.24
30 0.21
31 0.2
32 0.16
33 0.09
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.1
40 0.12
41 0.14
42 0.15
43 0.21
44 0.28
45 0.32
46 0.35
47 0.38
48 0.39
49 0.4
50 0.4
51 0.36
52 0.31
53 0.27
54 0.23
55 0.19
56 0.15
57 0.12
58 0.1
59 0.09
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.14
66 0.14
67 0.15
68 0.15
69 0.15
70 0.15
71 0.17
72 0.16
73 0.13
74 0.18
75 0.16
76 0.16
77 0.16
78 0.17
79 0.15
80 0.15
81 0.14
82 0.1
83 0.1
84 0.09
85 0.08
86 0.07
87 0.1
88 0.1
89 0.12
90 0.12
91 0.13
92 0.16
93 0.18
94 0.17
95 0.15
96 0.18
97 0.18
98 0.24
99 0.27
100 0.28
101 0.29
102 0.29
103 0.28
104 0.25
105 0.23
106 0.17
107 0.14
108 0.1
109 0.07
110 0.07
111 0.09
112 0.1
113 0.1
114 0.11
115 0.12
116 0.18
117 0.24
118 0.3
119 0.31
120 0.4
121 0.47
122 0.57
123 0.65
124 0.71
125 0.76
126 0.8
127 0.81
128 0.81
129 0.78
130 0.72
131 0.69
132 0.62
133 0.56