Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KAI5

Protein Details
Accession Q5KAI5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
151-170PLPHRRTKSKAWFAANRPSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 9.666, mito 9.5, cyto_nucl 8.833, nucl 8.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR028877  50S_L18Ae/Ribosomal_L18a/L20  
IPR023573  Ribosomal_L18a//L18Ae/LX  
IPR021138  Ribosomal_L18a/L20_eukaryotes  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cne:CNJ01560  -  
Pfam View protein in Pfam  
PF01775  Ribosomal_L18A  
Amino Acid Sequences MARFTEYSVVGRTLPTEADPAPKLYRMRIFAPNEVVAKSRYWYYLRQLKKAKKAHGEIVALNVIHEKKPLKVKNFAIWLRYDSRSGTHNMVKEFRALSRAEAVESMYQDMAARHRARFRNVQILRVAEVEKKDDIRRPYIKQLLEPGLKFPLPHRRTKSKAWFAANRPSTWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.19
6 0.2
7 0.23
8 0.24
9 0.28
10 0.28
11 0.31
12 0.36
13 0.34
14 0.37
15 0.42
16 0.44
17 0.43
18 0.46
19 0.44
20 0.39
21 0.36
22 0.33
23 0.26
24 0.22
25 0.2
26 0.17
27 0.17
28 0.18
29 0.21
30 0.28
31 0.35
32 0.39
33 0.46
34 0.54
35 0.59
36 0.66
37 0.7
38 0.69
39 0.7
40 0.7
41 0.67
42 0.64
43 0.58
44 0.48
45 0.43
46 0.37
47 0.28
48 0.23
49 0.2
50 0.14
51 0.12
52 0.14
53 0.12
54 0.14
55 0.24
56 0.3
57 0.32
58 0.38
59 0.41
60 0.44
61 0.52
62 0.49
63 0.42
64 0.37
65 0.36
66 0.32
67 0.3
68 0.25
69 0.18
70 0.17
71 0.17
72 0.19
73 0.19
74 0.18
75 0.2
76 0.21
77 0.22
78 0.21
79 0.21
80 0.2
81 0.16
82 0.16
83 0.14
84 0.13
85 0.15
86 0.15
87 0.13
88 0.13
89 0.13
90 0.12
91 0.12
92 0.12
93 0.08
94 0.08
95 0.08
96 0.08
97 0.09
98 0.15
99 0.16
100 0.18
101 0.26
102 0.29
103 0.34
104 0.41
105 0.44
106 0.48
107 0.47
108 0.49
109 0.45
110 0.43
111 0.39
112 0.33
113 0.3
114 0.22
115 0.22
116 0.21
117 0.19
118 0.21
119 0.24
120 0.28
121 0.31
122 0.36
123 0.41
124 0.44
125 0.52
126 0.55
127 0.54
128 0.51
129 0.54
130 0.53
131 0.52
132 0.47
133 0.4
134 0.38
135 0.36
136 0.34
137 0.32
138 0.35
139 0.34
140 0.43
141 0.49
142 0.55
143 0.6
144 0.7
145 0.76
146 0.75
147 0.79
148 0.79
149 0.79
150 0.75
151 0.81
152 0.75