Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NAW1

Protein Details
Accession A0A0E9NAW1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-68QLNVSTRPRSPKRRPPRVPRRKSHRSSGCNERYHydrophilic
NLS Segment(s)
PositionSequence
42-60RPRSPKRRPPRVPRRKSHR
Subcellular Location(s) nucl 20, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MTSHGLASPPNLKPALHLTLTTSTPLQHQSQSAYTQLNVSTRPRSPKRRPPRVPRRKSHRSSGCNERYPSSRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.25
4 0.24
5 0.23
6 0.25
7 0.26
8 0.24
9 0.19
10 0.15
11 0.15
12 0.18
13 0.17
14 0.15
15 0.15
16 0.16
17 0.18
18 0.19
19 0.19
20 0.16
21 0.15
22 0.14
23 0.14
24 0.13
25 0.13
26 0.14
27 0.15
28 0.18
29 0.27
30 0.34
31 0.43
32 0.52
33 0.62
34 0.7
35 0.78
36 0.85
37 0.88
38 0.92
39 0.93
40 0.93
41 0.93
42 0.92
43 0.92
44 0.87
45 0.87
46 0.86
47 0.82
48 0.8
49 0.8
50 0.79
51 0.77
52 0.73
53 0.67