Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NGR6

Protein Details
Accession A0A0E9NGR6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
103-132VPLPVPPRRPPLRRRRRRRRSPTTTWASVSHydrophilic
NLS Segment(s)
PositionSequence
108-123PPRRPPLRRRRRRRRS
Subcellular Location(s) cyto 12, nucl 9, mito 3, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05831  Ribosomal_P1  
Amino Acid Sequences MSTNELAISYAALILADEQAEITSDALLSLTKAANVTVEPIWASLFAKALEGKDVKELLLNVGGGGAPAAGMFCLMRGWLGVNGGVRVWSDVRTQFCVLPPLVPLPVPPRRPPLRRRRRRRRSPTTTWASVSSTKRLASSLSRLLGVNLLEFSLSSSIMNLDLAFSVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.05
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.08
23 0.11
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.07
32 0.08
33 0.07
34 0.09
35 0.09
36 0.1
37 0.13
38 0.14
39 0.14
40 0.15
41 0.16
42 0.14
43 0.14
44 0.14
45 0.11
46 0.11
47 0.11
48 0.08
49 0.07
50 0.07
51 0.05
52 0.05
53 0.04
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.03
63 0.03
64 0.03
65 0.04
66 0.04
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.06
75 0.06
76 0.07
77 0.08
78 0.11
79 0.13
80 0.16
81 0.17
82 0.17
83 0.17
84 0.19
85 0.17
86 0.15
87 0.14
88 0.12
89 0.11
90 0.1
91 0.11
92 0.14
93 0.21
94 0.24
95 0.26
96 0.34
97 0.41
98 0.49
99 0.58
100 0.63
101 0.68
102 0.75
103 0.84
104 0.87
105 0.91
106 0.95
107 0.96
108 0.96
109 0.94
110 0.93
111 0.92
112 0.88
113 0.81
114 0.72
115 0.63
116 0.55
117 0.52
118 0.45
119 0.39
120 0.34
121 0.3
122 0.29
123 0.27
124 0.27
125 0.24
126 0.27
127 0.29
128 0.27
129 0.28
130 0.27
131 0.27
132 0.27
133 0.23
134 0.17
135 0.12
136 0.1
137 0.09
138 0.09
139 0.1
140 0.08
141 0.08
142 0.07
143 0.07
144 0.08
145 0.08
146 0.09
147 0.07
148 0.07
149 0.07