Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NQ34

Protein Details
Accession A0A0E9NQ34    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-108GTYPATHPRRPRQQHRQRHRKTTSMTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MTSHISRVVSVLDEMADDDVRRHLSRNNSAVGRGEDRRRAGHVKTRRWKTATDDNPRPQRLSITFPHLENDIGRPHWAKERVGTYPATHPRRPRQQHRQRHRKTTSMTNSPEAHLRGCLPSLLNCTTSLVSHHNHLQSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.08
5 0.09
6 0.11
7 0.15
8 0.15
9 0.16
10 0.2
11 0.28
12 0.36
13 0.39
14 0.42
15 0.4
16 0.41
17 0.42
18 0.4
19 0.37
20 0.34
21 0.35
22 0.35
23 0.36
24 0.37
25 0.38
26 0.39
27 0.38
28 0.42
29 0.46
30 0.52
31 0.59
32 0.64
33 0.67
34 0.64
35 0.63
36 0.6
37 0.61
38 0.6
39 0.6
40 0.61
41 0.62
42 0.69
43 0.68
44 0.62
45 0.51
46 0.46
47 0.38
48 0.35
49 0.29
50 0.28
51 0.28
52 0.27
53 0.27
54 0.24
55 0.22
56 0.17
57 0.17
58 0.11
59 0.1
60 0.11
61 0.11
62 0.12
63 0.18
64 0.2
65 0.18
66 0.21
67 0.23
68 0.24
69 0.26
70 0.26
71 0.21
72 0.27
73 0.36
74 0.38
75 0.38
76 0.44
77 0.51
78 0.61
79 0.68
80 0.7
81 0.73
82 0.77
83 0.85
84 0.89
85 0.92
86 0.9
87 0.92
88 0.87
89 0.83
90 0.77
91 0.77
92 0.75
93 0.73
94 0.68
95 0.62
96 0.58
97 0.52
98 0.51
99 0.42
100 0.34
101 0.26
102 0.24
103 0.2
104 0.19
105 0.19
106 0.15
107 0.17
108 0.21
109 0.22
110 0.21
111 0.2
112 0.22
113 0.22
114 0.21
115 0.21
116 0.2
117 0.2
118 0.23
119 0.29