Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NCI1

Protein Details
Accession A0A0E9NCI1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
101-123ALTPLPLRRRLRRRRSPTTTWVSHydrophilic
NLS Segment(s)
PositionSequence
108-115RRRLRRRR
Subcellular Location(s) nucl 10, cyto 6, mito 5, extr 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
IPR044076  Ribosomal_P2  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002182  P:cytoplasmic translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05833  Ribosomal_P2  
Amino Acid Sequences MKYLAAYLLLTIGGNASPSAEDIKSVLSAVGIEADEERLSSLLKELEGKDINELIAEGSSKLSSVPSGGASAAASGGAAAAASYVPLLRPSMDFILTFCAALTPLPLRRRLRRRRSPTTTWVSASSTKRLIEYGSCTSIYPLKRSCNNTAVDALTSVHFTCPFIVNLRVFMFYYKCSGNDKPHLLTTNARITLNYFAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.1
7 0.09
8 0.1
9 0.1
10 0.11
11 0.11
12 0.11
13 0.1
14 0.07
15 0.07
16 0.07
17 0.08
18 0.06
19 0.06
20 0.06
21 0.08
22 0.07
23 0.07
24 0.08
25 0.06
26 0.07
27 0.06
28 0.08
29 0.08
30 0.09
31 0.12
32 0.12
33 0.19
34 0.21
35 0.21
36 0.21
37 0.2
38 0.19
39 0.16
40 0.15
41 0.09
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.07
78 0.08
79 0.09
80 0.09
81 0.08
82 0.12
83 0.11
84 0.11
85 0.09
86 0.08
87 0.07
88 0.07
89 0.08
90 0.06
91 0.11
92 0.13
93 0.21
94 0.25
95 0.34
96 0.45
97 0.55
98 0.64
99 0.7
100 0.78
101 0.81
102 0.85
103 0.83
104 0.81
105 0.78
106 0.71
107 0.61
108 0.53
109 0.46
110 0.44
111 0.39
112 0.33
113 0.28
114 0.26
115 0.24
116 0.23
117 0.21
118 0.17
119 0.19
120 0.2
121 0.19
122 0.19
123 0.19
124 0.2
125 0.24
126 0.23
127 0.23
128 0.24
129 0.28
130 0.34
131 0.4
132 0.44
133 0.45
134 0.46
135 0.43
136 0.41
137 0.36
138 0.3
139 0.25
140 0.2
141 0.14
142 0.14
143 0.12
144 0.11
145 0.1
146 0.1
147 0.11
148 0.12
149 0.13
150 0.15
151 0.2
152 0.19
153 0.22
154 0.22
155 0.22
156 0.2
157 0.21
158 0.2
159 0.17
160 0.2
161 0.18
162 0.19
163 0.23
164 0.29
165 0.35
166 0.42
167 0.46
168 0.46
169 0.5
170 0.51
171 0.48
172 0.47
173 0.45
174 0.46
175 0.43
176 0.4
177 0.35
178 0.34