Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9N9X3

Protein Details
Accession A0A0E9N9X3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
189-223EDAPKAKKAKTEEKKSKKDGEKKEKKAKKEKKSKABasic
NLS Segment(s)
PositionSequence
192-223PKAKKAKTEEKKSKKDGEKKEKKAKKEKKSKA
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013240  DNA-dir_RNA_pol1_su_RPA34  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
Pfam View protein in Pfam  
PF08208  RNA_polI_A34  
Amino Acid Sequences MSTSTEPTLSKELVSSDEEDSDVSDTEDVYTPPAGFTPLDTKTKSLLSASTLKDKEVWLFKVPAGTKMSEIKSLAVSAKTKRIGGEVEVGGKRWSVKEDVKEEAEFKLIAPTDKGYTVAHEPKFSKTITMTEAVDLPKIQYPEGDLSVPKKVQPEGMRMRFLPIGFGKGDPGVMGDFEGEERDGDVEMEDAPKAKKAKTEEKKSKKDGEKKEKKAKKEKKSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.18
4 0.18
5 0.18
6 0.17
7 0.16
8 0.15
9 0.12
10 0.1
11 0.09
12 0.08
13 0.1
14 0.11
15 0.1
16 0.11
17 0.12
18 0.11
19 0.11
20 0.11
21 0.11
22 0.09
23 0.11
24 0.15
25 0.19
26 0.23
27 0.24
28 0.25
29 0.26
30 0.27
31 0.26
32 0.22
33 0.18
34 0.18
35 0.25
36 0.26
37 0.32
38 0.31
39 0.31
40 0.31
41 0.3
42 0.31
43 0.29
44 0.3
45 0.24
46 0.26
47 0.25
48 0.3
49 0.3
50 0.3
51 0.27
52 0.25
53 0.24
54 0.27
55 0.28
56 0.25
57 0.25
58 0.21
59 0.19
60 0.19
61 0.18
62 0.16
63 0.17
64 0.16
65 0.22
66 0.23
67 0.23
68 0.22
69 0.22
70 0.21
71 0.19
72 0.22
73 0.16
74 0.2
75 0.19
76 0.19
77 0.18
78 0.17
79 0.16
80 0.12
81 0.13
82 0.12
83 0.16
84 0.21
85 0.24
86 0.26
87 0.27
88 0.27
89 0.27
90 0.23
91 0.2
92 0.14
93 0.11
94 0.11
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.08
103 0.09
104 0.14
105 0.2
106 0.19
107 0.22
108 0.23
109 0.24
110 0.26
111 0.24
112 0.21
113 0.16
114 0.17
115 0.16
116 0.17
117 0.15
118 0.13
119 0.16
120 0.14
121 0.14
122 0.12
123 0.11
124 0.11
125 0.11
126 0.11
127 0.09
128 0.11
129 0.13
130 0.14
131 0.14
132 0.12
133 0.14
134 0.18
135 0.18
136 0.18
137 0.18
138 0.17
139 0.22
140 0.24
141 0.31
142 0.37
143 0.42
144 0.43
145 0.41
146 0.43
147 0.39
148 0.36
149 0.32
150 0.23
151 0.21
152 0.19
153 0.19
154 0.17
155 0.15
156 0.15
157 0.1
158 0.1
159 0.07
160 0.07
161 0.07
162 0.05
163 0.06
164 0.06
165 0.07
166 0.06
167 0.06
168 0.06
169 0.06
170 0.07
171 0.07
172 0.07
173 0.06
174 0.07
175 0.07
176 0.07
177 0.09
178 0.09
179 0.15
180 0.17
181 0.18
182 0.23
183 0.3
184 0.41
185 0.5
186 0.61
187 0.67
188 0.76
189 0.84
190 0.86
191 0.89
192 0.88
193 0.88
194 0.88
195 0.88
196 0.88
197 0.89
198 0.92
199 0.9
200 0.9
201 0.91
202 0.91
203 0.9