Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0E9NMA8

Protein Details
Accession A0A0E9NMA8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MDPGARTRKRERPKQHKPTTNTTAIHydrophilic
NLS Segment(s)
PositionSequence
7-15TRKRERPKQ
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010259  S8pro/Inhibitor_I9  
IPR037045  S8pro/Inhibitor_I9_sf  
Pfam View protein in Pfam  
PF05922  Inhibitor_I9  
Amino Acid Sequences MDPGARTRKRERPKQHKPTTNTTAILRTLPRKMTAQSFIVRIKKDTPADEVTKIKEQITSSGGSIDHEYNTLFTGFSARIPEEAANSLKGHQHIDDMEVDQEMKTHHYGIGGFAPLYVIGWMEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.93
3 0.92
4 0.89
5 0.88
6 0.84
7 0.78
8 0.7
9 0.6
10 0.53
11 0.45
12 0.41
13 0.35
14 0.31
15 0.3
16 0.3
17 0.3
18 0.29
19 0.3
20 0.32
21 0.32
22 0.32
23 0.29
24 0.31
25 0.35
26 0.37
27 0.35
28 0.32
29 0.31
30 0.33
31 0.33
32 0.31
33 0.3
34 0.3
35 0.32
36 0.33
37 0.32
38 0.29
39 0.3
40 0.29
41 0.25
42 0.22
43 0.2
44 0.19
45 0.19
46 0.16
47 0.13
48 0.13
49 0.13
50 0.11
51 0.12
52 0.1
53 0.09
54 0.08
55 0.08
56 0.07
57 0.08
58 0.07
59 0.06
60 0.05
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.1
70 0.13
71 0.13
72 0.13
73 0.13
74 0.14
75 0.15
76 0.16
77 0.17
78 0.14
79 0.15
80 0.14
81 0.16
82 0.16
83 0.15
84 0.14
85 0.13
86 0.13
87 0.1
88 0.11
89 0.1
90 0.11
91 0.11
92 0.11
93 0.11
94 0.13
95 0.13
96 0.15
97 0.17
98 0.16
99 0.15
100 0.13
101 0.13
102 0.11
103 0.12
104 0.09