Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KGY2

Protein Details
Accession Q5KGY2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
266-288GGNIKENEKAGKKKNKKKKSIAABasic
NLS Segment(s)
PositionSequence
273-287EKAGKKKNKKKKSIA
Subcellular Location(s) plas 23, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009580  GPI_biosynthesis_protein_Pig-F  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0051377  F:mannose-ethanolamine phosphotransferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
KEGG cne:CNE01940  -  
Pfam View protein in Pfam  
PF06699  PIG-F  
Amino Acid Sequences MAPALPLPEYFTLLIYLAILLIAAFTSLPHSTSYFLSAPLAQSSSADRPEHPFLTPITSRPLITMAWDVIGVGMIMFWWGGKMKGWWEGKSVAKKEEIVGESDMEERTRRTTKMFARFKEAGMATAGMALVYYLFLFLMGAPLNSYFSHSLLLALHLSILTVWTPVYTLGIPSMYDQGIYARFRMTRLFCQFQPENPIERALVYPVIGTFVGAWIGAIPIALDWDRPWQSYPLTVAFASILGFIVGGFASWTHSVGEDMYKEVSAGGNIKENEKAGKKKNKKKKSIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.09
4 0.07
5 0.06
6 0.05
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.06
14 0.07
15 0.08
16 0.1
17 0.11
18 0.13
19 0.14
20 0.19
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.17
27 0.17
28 0.13
29 0.13
30 0.16
31 0.19
32 0.22
33 0.22
34 0.22
35 0.27
36 0.32
37 0.33
38 0.29
39 0.27
40 0.23
41 0.29
42 0.29
43 0.25
44 0.26
45 0.26
46 0.25
47 0.24
48 0.25
49 0.18
50 0.19
51 0.19
52 0.13
53 0.12
54 0.11
55 0.1
56 0.08
57 0.08
58 0.06
59 0.04
60 0.03
61 0.02
62 0.03
63 0.03
64 0.02
65 0.03
66 0.04
67 0.04
68 0.06
69 0.07
70 0.09
71 0.17
72 0.21
73 0.21
74 0.23
75 0.28
76 0.33
77 0.4
78 0.41
79 0.35
80 0.34
81 0.33
82 0.32
83 0.33
84 0.28
85 0.22
86 0.2
87 0.18
88 0.17
89 0.17
90 0.17
91 0.11
92 0.11
93 0.1
94 0.13
95 0.16
96 0.16
97 0.18
98 0.25
99 0.32
100 0.42
101 0.49
102 0.46
103 0.51
104 0.51
105 0.49
106 0.47
107 0.39
108 0.29
109 0.22
110 0.21
111 0.13
112 0.12
113 0.11
114 0.05
115 0.05
116 0.04
117 0.03
118 0.03
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.06
131 0.06
132 0.08
133 0.07
134 0.08
135 0.09
136 0.08
137 0.09
138 0.08
139 0.09
140 0.07
141 0.06
142 0.05
143 0.05
144 0.05
145 0.04
146 0.04
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.05
154 0.04
155 0.05
156 0.05
157 0.05
158 0.06
159 0.06
160 0.08
161 0.07
162 0.07
163 0.07
164 0.08
165 0.11
166 0.12
167 0.11
168 0.12
169 0.12
170 0.13
171 0.18
172 0.2
173 0.25
174 0.31
175 0.35
176 0.33
177 0.4
178 0.41
179 0.38
180 0.42
181 0.36
182 0.33
183 0.3
184 0.31
185 0.23
186 0.23
187 0.21
188 0.16
189 0.14
190 0.1
191 0.09
192 0.08
193 0.09
194 0.08
195 0.07
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.04
202 0.04
203 0.04
204 0.03
205 0.03
206 0.03
207 0.05
208 0.05
209 0.05
210 0.06
211 0.13
212 0.15
213 0.16
214 0.18
215 0.19
216 0.2
217 0.22
218 0.24
219 0.2
220 0.21
221 0.2
222 0.18
223 0.16
224 0.15
225 0.13
226 0.1
227 0.08
228 0.05
229 0.05
230 0.04
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.07
238 0.08
239 0.08
240 0.09
241 0.09
242 0.1
243 0.13
244 0.12
245 0.13
246 0.13
247 0.13
248 0.12
249 0.12
250 0.12
251 0.11
252 0.13
253 0.12
254 0.18
255 0.19
256 0.21
257 0.23
258 0.24
259 0.3
260 0.35
261 0.43
262 0.46
263 0.56
264 0.66
265 0.74
266 0.84
267 0.88
268 0.9