Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0E9NM86

Protein Details
Accession A0A0E9NM86    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-34AAGGKAAKKKKWSKGKVKDKAQNKVMHydrophilic
NLS Segment(s)
PositionSequence
12-28GKAAKKKKWSKGKVKDK
Subcellular Location(s) mito 14.5, mito_nucl 9.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKSAAVQAAGGKAAKKKKWSKGKVKDKAQNKVMLDQATYDKLFKEVGSYRLVSISVLVDRLKINGSLARRALKELEEQGVIKKVDTHHAQQIYTRAIAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.4
4 0.48
5 0.57
6 0.67
7 0.75
8 0.8
9 0.83
10 0.9
11 0.9
12 0.91
13 0.89
14 0.87
15 0.86
16 0.8
17 0.75
18 0.66
19 0.59
20 0.53
21 0.45
22 0.36
23 0.28
24 0.25
25 0.2
26 0.19
27 0.15
28 0.12
29 0.12
30 0.12
31 0.1
32 0.12
33 0.12
34 0.14
35 0.16
36 0.16
37 0.16
38 0.16
39 0.16
40 0.12
41 0.1
42 0.08
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.09
52 0.11
53 0.13
54 0.16
55 0.19
56 0.22
57 0.22
58 0.23
59 0.24
60 0.22
61 0.24
62 0.23
63 0.22
64 0.2
65 0.2
66 0.21
67 0.25
68 0.23
69 0.19
70 0.2
71 0.19
72 0.25
73 0.29
74 0.32
75 0.35
76 0.38
77 0.38
78 0.38
79 0.42
80 0.38
81 0.34
82 0.29