Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q5KA15

Protein Details
Accession Q5KA15   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRRARNPNQQKKKKKKKKQFIRNPFGLPPBasic
NLS Segment(s)
PositionSequence
4-19ARNPNQQKKKKKKKKQ
Subcellular Location(s) nucl 13.5, plas 10, cyto_nucl 8, mito 2
Family & Domain DBs
Amino Acid Sequences MRRARNPNQQKKKKKKKKQFIRNPFGLPPNSRSKFPNTFPFHSTVLPFPSIIDSVVVLLSIRSPFARFRADPFPFHPHLATFSPILGVCLVACMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.96
3 0.96
4 0.97
5 0.97
6 0.97
7 0.96
8 0.95
9 0.9
10 0.84
11 0.77
12 0.71
13 0.64
14 0.56
15 0.5
16 0.5
17 0.45
18 0.42
19 0.4
20 0.41
21 0.43
22 0.44
23 0.49
24 0.46
25 0.47
26 0.47
27 0.48
28 0.43
29 0.37
30 0.34
31 0.25
32 0.2
33 0.17
34 0.15
35 0.12
36 0.11
37 0.1
38 0.09
39 0.07
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.03
46 0.04
47 0.04
48 0.05
49 0.05
50 0.07
51 0.09
52 0.12
53 0.18
54 0.17
55 0.22
56 0.32
57 0.34
58 0.36
59 0.4
60 0.44
61 0.41
62 0.42
63 0.38
64 0.29
65 0.31
66 0.3
67 0.27
68 0.2
69 0.18
70 0.18
71 0.17
72 0.17
73 0.12
74 0.11
75 0.08